KEGG   Gallus gallus (chicken): 423374Help
Entry
423374            CDS       T01006                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00350  Tyrosine metabolism
gga01100  Metabolic pathways
Module
gga_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    423374 (GSTZ1)
Enzymes [BR:gga01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     423374 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 423374
NCBI-ProteinID: NP_001264391
CGNC: 7940
Ensembl: ENSGALG00000010432
UniProt: A0A3Q3AE45
Position
5
AA seq 217 aa AA seqDB search
MSSAAVKPILYSYFRSSCSWRVRIALALKGIAYDQVPVNLVKDGGQQFSAEFKAVNPMKQ
VPALKIDGITITQSLAIIQYLEDTRPNPRLLPQDPKKRAQVRMISDHIASGIQPLQNLSV
LNKVGERKMEWAQQCITSGFQALEQILQHTAGRYCVGDEVSMADLCLVPQAANAERYGVS
LDPYPTITRINKALLELEAFKVSHPSRQPDTPAELRS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgccgcagtcaagccaatactttacagctatttccgaagctcctgttcatgg
agagtgagaatcgcgctggctcttaaagggattgcctatgaccaggtgccagtgaacctc
gtgaaggacggggggcagcagttttctgctgaattcaaagcagtgaatccaatgaagcaa
gtcccagccttgaaaattgatggtatcaccattacacagtcgctggctataattcagtac
ctagaagacactcgtcctaacccgaggctcttgccccaggatccaaagaagagagcccaa
gtcagaatgatctcggatcacattgcttctggcattcagccactccagaatttgagtgtc
ctgaacaaagtgggggagagaaaaatggaatgggctcagcagtgcatcacatctggattc
caagcactagaacagattctgcagcacactgctggccgctactgtgtgggagatgaggta
tccatggctgatctgtgcttggtgcctcaagctgccaatgctgaaagatacggtgtgagc
ctggatccatatcctacaataactagaataaacaaagctctcctggagttagaggcattc
aaagtaagccacccatcccgacagccagacactcctgcagagctgcgatcttga

DBGET integrated database retrieval system