KEGG   Gallus gallus (chicken): 423428Help
Entry
423428            CDS       T01006                                 

Gene name
ASB2
Definition
(RefSeq) ankyrin repeat and SOCS box protein 2
  KO
K10324  ankyrin repeat and SOCS box protein 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    423428 (ASB2)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     423428 (ASB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank_5 Ank SOCS_box
Motif
Other DBs
NCBI-GeneID: 423428
NCBI-ProteinID: XP_015143246
CGNC: 8268
Ensembl: ENSGALG00000010881
UniProt: E1C770
Position
5
AA seq 645 aa AA seqDB search
MATTAANTQRQTIGSEEYSLYSSLSEDELINMAIQQSLGEDPVGHAAAQGHPKPLGGGPS
EAASPSRANSHNPPYHLYPWQRLAARGRIQPPNAGAAWAVRRRYDGSLFSTAQPIELDPV
VAAIRDGDEKEICNMMKSGKDLSEPNKDGWLPLHEAAYYGQVGCLRLLQKAYPGTIDQRT
LNEETALFLATSRGNLDCLLALLQAGAEPDISNKARETPLYKACERKNAEAARLLVQYNA
DTNHRCNRGWTALHEAVSRNDLEIMDILVKGGAKIESTNSYGITSLFVAAESGQLEALRY
LAKCGADINTQASDSASALYEACKNGHVHIVEFLLSQGADANKANKDGLLPLHIAAKKGI
CEIVSMLIPVTSRIRVKRSGISPLHLAAERNNDDILEELIDAGYEVNTTLSNERSCLYED
RRTTPLYFAVFNNNIYATELLLQAGANPNIDLINPLLISIRHGCLTTMKLLLDHGANIDA
YISSHPTTFPATIMFSMKYLSVLKYLLDLGCDAVSCFQCQYGNCPHPALNYRRDRFNDPQ
LSKEPTITQFCDMVSAPEISRWAGPIIDVLLDYVGNVQLCSRLKEHIDSYEDWAVIKEKA
EPPRPLAHLCRVKVRSLIGRNRIKLIDTLPLPYRLIRYLQHDYTQ
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggctacaacggcggcaaacacccaacgacaaacaataggcagcgaggaatacagtctg
tacagcagcctgagcgaggacgagctgatcaacatggccatccagcagagcctgggggag
gacccggtgggccatgcagcggcccagggccacccaaagcctctgggagggggacccagc
gaggcagcttcccccagccgtgccaacagccacaaccctccctaccacctctacccttgg
caaagattggcagccagaggccgcattcagccgcccaacgcaggggcagcctgggcggtc
aggcgaaggtacgacggcagcctcttcagcacagcccagcccatagaacttgaccctgtg
gtagcagcaatcagggatggagatgaaaaagagatatgcaacatgatgaaatcaggaaaa
gacctctctgaacctaataaggatggctggttacccctccatgaagctgcgtactatggc
caagtgggttgcctgcgcctgttgcaaaaagcataccctggcacaatcgaccagcgcacc
ctcaatgaggagacagctctcttcctggccaccagccggggcaacctggactgcttgctt
gccctgctgcaggctggggctgagcctgacatctccaacaaggccagagaaactcccctc
tacaaagcctgtgagcgcaagaatgcagaggctgcaagactcctggtacagtacaatgct
gataccaaccaccgctgcaatcgaggatggactgctctccatgaggctgtctccagaaat
gacctggagattatggatatcctggtgaaagggggtgccaagattgagtctacaaactcc
tatgggatcacttctttatttgtggcagctgagagtgggcagttggaagctctgagatac
ctggcaaaatgtggtgctgatataaatactcaagccagtgatagtgcttctgctctttat
gaagcctgtaaaaatggacatgtacatattgtagagtttcttttgtcccaaggagctgac
gctaacaaagccaataaggatggcctcctacctcttcacatagcagccaaaaagggaatt
tgcgagattgtttccatgctgattcctgtgactagtcgcatccgcgtcaagcgcagtggc
atcagtcccctgcatttagcagctgaacgcaacaatgatgacatcttggaagagctaatt
gatgctggctatgaggtgaacaccaccctctccaatgaacggtcctgcctttacgaggac
agacgcaccacacctctctattttgctgtttttaacaacaatatctatgccacagagctc
ctgttgcaagctggagccaaccccaacattgacctcatcaacccactgcttatctccata
cgccacggttgcctgacaacaatgaaactgcttcttgaccatggagcaaacattgatgcc
tatatttcaagccatcccaccacgtttccagctaccatcatgttttcaatgaagtacctt
tctgtgctgaagtatctcctggatcttggctgtgatgctgtttcctgttttcagtgccag
tatggaaactgcccacaccctgctttaaattacaggcgggacagatttaatgatcctcag
ctgtccaaagaaccaaccataacacagttctgtgatatggtgtctgctccagagataagt
cgctgggctgggccaattattgatgttctcctggattatgtgggtaacgtccagctctgt
tcccggctgaaggagcatatagacagctacgaggactgggctgtcattaaagaaaaagca
gagcctccacgacctcttgctcatctttgccgtgtcaaggtacgaagcttgattggaaga
aaccgcattaaacttattgacacattgcctcttccatacagactgattcgatacttacag
catgattacacacagtga

DBGET integrated database retrieval system