KEGG   Gallus gallus (chicken): 423437
Entry
423437            CDS       T01006                                 

Gene name
DICER1
Definition
(RefSeq) endoribonuclease Dicer
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    423437 (DICER1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     423437 (DICER1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    423437 (DICER1)
   microRNA pathway
    RISC loading complex
     423437 (DICER1)
SSDB
Motif
Pfam: Ribonuclease_3 PAZ Dicer_dimer Ribonucleas_3_3 Helicase_C ResIII DEAD DUF2075 dsrm Flavi_DEAD
Other DBs
NCBI-GeneID: 423437
NCBI-ProteinID: NP_001035555
CGNC: 8359
Ensembl: ENSGALG00000010999
UniProt: Q25BN1
Position
5
AA seq 1921 aa
MKSPALQSLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELSYQIRGDFNKNGKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSSLEVTESWTKEKWSQEFSKHQVLVMTCHVALTVLRNEYLSLSNINLLVFDECHLA
IQDHPYREIMKICEDYPSCPRILGLTASILNGKCDPAELEEKIKKLEKILKSNAETATDL
VVLDRYTSQPCEIVVDCGPYTDKSGLYGRLLRELDEALHFLNDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE
EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDE
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTSETE
TEPIVDDDDVFPPYVLRTDENSPRVTINTAIGHINRYCARLPSDPFTHLAPKCKTRELPD
HTFYSTLYLPINSPLRASIVGPPMSCARLAERVVALICCEKLHKIGELDDHLMPVGKETV
KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPKPDQPCYLYVIGMVLTTP
LPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSL
QMLELITRLHQYIFSHILRLEKPALEFKPTEADSAYCVLPLNIVDDSSTLDIDFKFMEDI
EKSEARTGIPSTQYTKEMPFIFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF
PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKR
KAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTATDAGV
GVKSLPADFRYPNLDFGWKKSIDSKSFISIPSSSLVENENYCKHSTIVVPENAAHQGANR
TSSAEKHDQMSVSYRTLLDESPSKLQIDVSAELAAINGVSYNKNLANGNCDLVNRDFCQG
NQLNYCRQEIPVQPTTSYPIQNLYSSENQPKPSNECTLLSNKYLDGNANRSTSDGCPKMT
VTTSTSTALNLSKDKVDSEKNTSSGYSSKTLGPNPGLILQALTLSNASDGFNLERLEMLG
DSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVN
WLPPGYIVNQDKSNTDKWEKEETTKENLLANGKLDYDDDDEEDEDLMWRLPKEETDFEDD
FLEYDQEHIKFIDSMLMGSGAFVKKISLSHFSTTDSNYEWKAPKKSSLGNVPFSSDFDDF
DYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDAGKQSISYDLHTEQCIADKSIAD
CVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKKTDWESTLCATGENCNSEQKNLSPNS
VSACIVNSEPSLYKDLEYGCLKIPPRCMFDHPDAEKTLNHLISGFENFEKKINYSFKNKA
YLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVN
NTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQMEKNEMQGMDSELRRSEEDEEKEED
IEVPKAMGDIFESLAGAIYMDSGMSLEMVWQVYYPMMRPLIEKFSANVPRSPVRELLEME
PETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVPN
S
NT seq 5766 nt   +upstreamnt  +downstreamnt
atgaaaagccctgctttgcaatccctcagcatggcgggactgcagctcatgacccctgct
tcctccccaatgggtccattttttggactaccgtggcaacaagaagcaattcatgataac
atttatacgccaagaaaatatcaggttgaactgcttgaagcagctttggatcataataca
atagtctgtttaaacactggctcagggaagacttttattgcagtactactcactaaagag
ctgtcctatcagatcaggggggatttcaacaaaaacggaaaaagaactgtgttcttggtc
aactcagcaaatcaagttgctcagcaagtgtcagctgtcaggacacattcagatcttaaa
gtgggagagtattcaagtttagaggtaactgaatcatggacaaaagagaaatggagtcag
gaattctctaagcatcaggttctggttatgacatgtcatgttgctttgactgttttgaga
aatgagtatttatccctatcaaatattaatctactggtgtttgatgagtgccatcttgca
atccaggaccatccataccgtgaaattatgaagatctgtgaggattacccatcttgccct
cgaatcttgggattaactgcttccattttaaatgggaagtgtgatcctgctgagttagaa
gaaaagataaagaaactggagaaaatactaaagagcaatgctgaaactgcaactgatttg
gtggtcttagatagatatacttctcagccatgtgagattgttgtagactgtggaccatat
actgacaaaagtggattgtacggaagactattaagggaattagatgaagcacttcatttt
ctaaatgactgcaacatatctgtacattcaaaggaaagagattctacgttaatttctaaa
cagatattgtcagactgtcgagctgtgttggttgttctgggaccctggtgtgcagataag
gtagctgggatgatggtgagagagctacagaagtatatcaaacatgagcaagaggagctg
cacaggaaatttttattgtttacagacactttccttaggaaaatacatgcactctgtgaa
gagcatttctcacctgcctcacttgacctgaaatttgtaactccaaaagtaataaagctg
cttgaaatcttgcgcaaatacaaaccatatgaacggcagcagttcgaaagtgttgaatgg
tataacaatagaaatcaggataattatgtatcatggagtgattctgaagatgatgatgaa
gatgaagagattgaggagaaagagaagccagagactaatttcccatctccttttacgaat
attttatgtggaattatttttgtggaaagaagatacacagcagttgttctaaataggttg
ataaaagaagctggcaaacaggatccagaactggcttacatcagtagcaatttcataact
ggacatggcattggcaagaatcagcctcgtaacaagcagatggaagtagaattcagaaag
caggaagaggttcttagaaaatttcgagcacacgagaccaatcttcttatcgctaccagt
attgtagaagagggtgttgacataccaaaatgcaatttggtggtgcgttttgatttgccc
acagaataccgttcctatgtgcagtcaaaaggaagagctagagcaccaatttccaattat
ataatgttagcagatacagacaaaattaaaagttttgaggaagatcttaagacatataaa
gcaattgagaagatcctgaggaataaatgctcaaaatctgttgataccagcgaaaccgaa
actgaacccattgttgatgatgatgatgtgtttccaccctatgtgctgaggacagatgag
aacagtccaagagttactatcaacactgcaattggacacataaataggtactgcgctaga
ttaccaagtgatccatttacacacctagctcccaagtgtaaaacccgagaactacctgat
catacattctactctactctctacctgccaatcaactcacctcttcgagcatcaattgtt
ggtcctccaatgagttgtgcaagattggctgagagagttgtagctcttatttgctgtgaa
aaactgcacaaaatcggtgaactggatgaccatttgatgccagttggaaaagaaactgtt
aaatatgaggaagagcttgatttacatgatgaagaagaaaccagtgtgccaggaagacca
ggctctacaaaaagacgacagtgctaccctaaagctattccagaatgtttgagggatagt
tatcccaaacctgatcagccctgttacctgtatgtaataggaatggtgttaactactcca
ttgcctgatgagctcaactttaggagacgaaagctatatcctcctgaggatacgacgaga
tgttttggcatattgacagccaaacctatacctcagattcctcactttcctgtgtatact
cgctctggagaggttacaatatctattgagcttaagaaatctggttttactttgtctttg
caaatgcttgagctgataacacgactccaccagtacattttctcacatattcttcgtctt
gagaaacctgcactagagttcaaacccacagaagctgattcagcctattgtgttctacct
cttaacattgttgatgactccagcactttggacattgactttaagtttatggaagacatt
gaaaagtctgaagcgcgtacaggcattcccagtacacagtatacaaaagaaatgcctttt
attttcaagttagaagactaccaggatgcagttatcattccacggtatcgaaattttgat
cagcctcatcgattctatgtagctgatgtatacactgatcttactccactcagtaaattc
ccttcccctgaatatgaaacttttgctgaatattataaaacaaaatataatcttgacctg
accaatctcaaccagccgctgctggatgtggaccacacatcttcaagacttaatcttttg
actcctcgccatttgaatcagaaggggaaagcacttccactaagcagtgctgagaagagg
aaagcaaaatgggaaagtctgcagaataagcagatactggttcctgagctatgtgctata
catcctattccagcatcgttgtggagaaaagcagtttgcctccccagcatactttatcgc
ctgcactgccttttgacagcagaggaactaagagctcaaacagccactgatgctggcgta
ggggttaaatcacttcctgcagatttcagatatcctaacctggacttcggatggaaaaaa
tctattgacagcaaatctttcatctccatacctagctcctctttggtagagaatgaaaat
tactgtaagcacagcacaattgtagtccctgaaaatgctgcacatcaaggtgctaataga
acctcttctgcagaaaaacatgaccaaatgtctgtgagttacagaacactgcttgatgag
tcacccagtaaactccaaattgatgtctcagcagaacttgcagcaattaatggtgtttct
tataataaaaatcttgccaatggcaattgtgatttagttaacagagacttttgccaagga
aatcagctgaattactgcaggcaggaaatacctgtacaaccaactacctcatatcccatt
cagaatttatacagcagtgagaaccagcccaagcccagcaatgaatgtactctactgagt
aataaataccttgatggaaatgctaacagatctacctcagatggatgccccaaaatgaca
gtgaccaccagtacttcaacagctcttaatctttcaaaagacaaagtggattctgaaaag
aacacttccagtgggtactcctcaaaaactcttggtcctaatcctggtctcattcttcag
gctttgactctttcaaatgctagtgatggatttaatttggagcggctagaaatgcttggt
gattcatttttaaagcatgccatcactacatacttgttttgcacttaccctgatgcacac
gagggacggctgtcatacatgagaagtaaaaaagtcagcaactgtaatttgtatcgcctt
ggaaaaaagaaaggactgcctagtcgaatggtggtatcgatttttgatccccctgtcaat
tggcttcctcctggttacatagtaaaccaggacaagagcaacactgacaaatgggagaaa
gaagaaacgacaaaggagaatttgttggctaatggtaaacttgattatgatgatgatgac
gaagaggatgaagacctaatgtggaggttgcccaaggaagaaacagactttgaagatgat
tttttggagtatgatcaagagcatatcaaattcatagatagtatgttaatgggatcgggg
gcttttgtgaagaaaatttctctctctcacttttcaaccactgattcaaactatgaatgg
aaagcacccaaaaagtcatccctgggtaatgttccgttttcatcagattttgatgatttt
gactacagctcttgggatgctatgtgctatctggatcctagcaaggctgttgaagaggat
gattttgtagtgggtttctggaatccatcagaagaaaactgtggtgtcgatgcaggaaaa
cagtctatctcatatgatttgcatacagagcagtgtattgctgacaaaagcattgcagac
tgtgtggaagccctgttgggctgctatctgaccagctgtggtgaaagagctgctcagctt
ttcctgtgttcactggggctgaaggtgctccctgtaattaaaaagactgattgggaaagc
actctgtgtgcgactggagagaactgtaacagtgagcagaagaatctttcaccaaactct
gtttctgcttgtatagttaattcagagccttctctttataaagacctggagtatggttgt
ttgaagatcccaccaaggtgtatgtttgatcacccagatgctgaaaaaaccctgaatcac
cttatttctggttttgaaaactttgagaagaaaattaattacagttttaagaacaaggcg
tatcttcttcaggcatttactcatgcctcataccattataataccattactgattgttac
cagcgcttagaattcctgggagatgcaattttggactacctcataaccaagcacctttat
gaagacccacggcaacactcaccaggagttcttactgacctgcgatctgctctagtcaat
aataccatttttgcatcgctagctgtaaagtatgactaccacaagtacttcaaagctgtc
tctcctgaactgtttcatgttattgatgactttgtgcagtttcaaatggaaaagaatgaa
atgcaaggaatggattcagagctcagaagatctgaagaagatgaagaaaaggaggaagac
attgaagtaccaaaggccatgggggatatatttgagtcccttgctggtgccatttatatg
gatagtggaatgtctttggaaatggtttggcaagtgtactatccaatgatgaggccatta
atagaaaagttttctgctaatgtgccccgttccccagtgcgagagctgcttgagatggag
ccagagacggccaagtttagtcctgcagaaagaacttacgatgggaaggtcagagtaact
gtggaagttgtaggaaagggaaagtttaaaggtgttggcagaagctacaggattgccaaa
tctgcagctgcgagaagagcactacgaagcctcaaagcaaatcaacctcaggtcccaaac
agctga

DBGET integrated database retrieval system