KEGG   Gallus gallus (chicken): 423455
Entry
423455            CDS       T01006                                 

Gene name
YY1
Definition
(RefSeq) transcriptional repressor protein YY1
  KO
K09201  transcription factor YY
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    423455 (YY1)
   03036 Chromosome and associated proteins [BR:gga03036]
    423455 (YY1)
   03029 Mitochondrial biogenesis [BR:gga03029]
    423455 (YY1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    423455 (YY1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     423455 (YY1)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    423455 (YY1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 IBR Raffinose_syn
Other DBs
NCBI-GeneID: 423455
NCBI-ProteinID: NP_001026381
CGNC: 51971
Ensembl: ENSGALG00000017388
UniProt: Q5ZMN5
Position
5
AA seq 420 aa
MASGDTVYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGGEEDEEEEDEDECCEDCG
PHHPPHHYHHHQPMIALQPLVSDGDPSGAGGGAAGGGGGQLHLHHHHQEVILVQTREEVV
GGDDSDGLRADDGFEDQILIPVPAPAGEDEYIEQTLVTVAAAGSKSGGGGSSSAGGGGRV
KKGGSGKKSSKKSYLSGGGGGGAEGGGGRKWEQKQVQIKTLEGEFSVTMWASDDKKDIDH
ETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPR
TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQ
CTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcctcgggagacaccgtgtacatcgccaccgacggctcggagatgccggccgagatc
gtggagctgcacgagatcgaggtggagaccatcccggtggagaccatcgagaccaccgta
gtgggcggcgaggaggacgaggaggaggaggacgaggacgagtgctgcgaggactgcggc
ccgcaccacccgccgcaccactaccaccaccaccagcccatgatcgccctgcagcccctc
gtctcggacggagaccccagcggggcgggcggcggcgcggccggcggcggcggggggcag
cttcacctgcaccaccaccaccaggaggtgatcctggtgcagacccgcgaggaggtggtg
gggggtgacgactcggacgggctgcgggccgacgacggcttcgaggaccagattctcatc
ccggtgccggcccccgccggcgaggacgagtacatagagcagaccctggtcaccgtggcc
gccgccggcagcaagagcggaggcggcgggtcctcctcggccggggggggaggccgcgtg
aagaagggcggcagcggcaagaagagcagcaagaagagttacctgagcgggggaggcggc
ggcggggccgagggcggcggcggcaggaaatgggagcagaagcaggtgcagatcaagacc
ctggagggggagttctcggtcaccatgtgggcctcggatgataaaaaagatattgaccat
gaaacagtggtggaagagcagatcattggagagaattctcctccagattactcagagtac
atgacaggaaagaagcttcctcctggtggaatacctggcattgacctctcggaccctaag
cagctggctgaatttgctagaatgaagccaagaaaaattaaggaagatgatgctccacgt
acgatagcttgtcctcacaaaggctgcacaaagatgttcagggacaactctgctatgagg
aagcatctgcacactcatggccctcgagtacatgtatgtgcagaatgtggcaaagccttt
gtggagagctcgaaactaaagcgacatcaactagttcatactggagagaaaccctttcag
tgtacatttgaaggatgtggaaagcgtttttcactggacttcaatttacgcacacatgtg
cgaattcatactggcgacaggccctatgtttgcccatttgatggctgcaataagaagttt
gcgcaatcaactaacctgaaatctcacattttaacacatgctaaggccaaaaacaaccag
tga

DBGET integrated database retrieval system