KEGG   Gallus gallus (chicken): 423480Help
Entry
423480            CDS       T01006                                 

Gene name
MARK3
Definition
(RefSeq) MAP/microtubule affinity-regulating kinase 3 isoform X15
  KO
K08798  MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    423480 (MARK3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    423480 (MARK3)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     423480 (MARK3)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   423480 (MARK3)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     423480 (MARK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr KA1 Kinase-like UBA RIO1 Kdo UBA_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 423480
NCBI-ProteinID: XP_001234619
CGNC: 8742
Ensembl: ENSGALG00000011505
UniProt: A0A3Q2UAK5
Position
5
AA seq 729 aa AA seqDB search
MSTRTPLPTVNERDTENHTSHGDGRQEVSSRTGRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG
VILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPTKRGTLEQ
IMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSISSSQKQRRYSD
HAGPSIPPVVAYPKRSQTSTTDSDLKEEGIQSRKSSSSAVAGRGIAPASPMLGNASNPNK
ADIPERKKSSAVPSNNTAPGAMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSATTPDRIRFPRGTASRSTFHGQLRERRTATYNGPPASPSLSHEATPLSQTRTRG
STNLFSKLTSKLTRSRNVAVDQKDENKEAKPRSLRFTWSMKTTSSMDPNDMMREIRKVLD
ANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIA
SKIANELKL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcggactccattgcccacggtgaacgagcgcgacaccgagaaccacacgtcc
catggagatggacggcaggaagtttcctctcgaactgggcgctccggagctcgttgcagg
aattctatagcttcctgtgcagatgagcaaccacacattggaaattacagactcctcaaa
acgattggaaaggggaattttgcaaaagtaaagctggcgagacacatcctcacaggcaga
gaggttgccataaagataattgacaaaacacagctgaatccaaccagtctacaaaagctc
tttagagaagtaagaataatgaagatcttaaatcatccgaatatagtgaagttatttgaa
gtcatcgaaactgaaaaaactctctatttaataatggaatatgcaagtgggggggaggtg
tttgactatctggttgcgcatggaagaatgaaggaaaaggaagcaagagctaaatttagg
cagatagtatctgcagtgcagtactgccatcaaaagcatattgttcatagagatctcaag
gctgaaaatctattgctagatgcagatatgaacattaaaatagccgactttggttttagc
aatgagtttacagttggaaataaactggacaccttttgtggcagcccaccgtatgctgct
ccagaactttttcaagggaaaaaatacgatggacctgaagtagatgtttggagtttaggt
gttattctttataccctcgtgagtggatctcttccttttgatgggcagaacttaaaggaa
cttagagagagagtactaaggggaaaataccggattcctttctacatgtccacagactgt
gaaaacctcctcaaacgtttcctggtgctaaacccaacaaaaagaggcactctagagcaa
attatgaaggacaggtggatcaatgcagggcatgaggaggatgaacttaaaccttttgtt
gaaccagaactagacatctcggaccagaaaagaatagatattatggtaggaatgggatat
tctcaagaagaaattcaagaatcccttagtaaaatgaagtatgatgaaatcacagctaca
tacttattgctaggaaggaaatcatcagagttggatgcaagtgattcaagctccagcagc
aatctttcacttgctaaagttcggccaagtagtgatcttaataatagcactggacaatct
cctcatcacaaagttcagagaagcatatcttctagccagaagcagaggcgctacagcgat
catgctggaccatccatccccccagtagtggcatatcccaaaagaagccaaactagtact
acagacagtgacctaaaagaggaaggaattcaatcaagaaaatctagcagtagtgctgtt
gcaggaagaggaattgcaccagctagtccaatgcttggaaatgccagcaatccaaataag
gctgatattcctgaacgtaagaaaagttcggctgtccctagtaataatactgcccctgga
gcaatgacacggcgcaacacatatgtttgtagtgaaagaaccactgctgataggcattca
gtgatacaaaatggcaaggagaacagcactattcccgatcaaagaacgcctgtcgcttca
actcacagcataagcagtgcaaccacacctgaccgtattcgtttccccagaggaacggcc
agccggagcaccttccacggccagctccgcgagcgacgcaccgctacctacaacgggccc
ccggcctcccccagcctgtcccacgaggcaacgccgctctctcagactcgaaccaggggt
tccactaacctgttcagcaaactaacttcaaaactcacaaggagccgcaatgtagctgtg
gatcagaaggacgaaaacaaggaagccaagcctcgctcgctgcgttttacatggagcatg
aaaaccaccagctccatggatcccaatgacatgatgagggaaatccggaaggtcctggat
gccaataattgtgactatgaacaaagagagcgtttcttgcttttctgcgtccatggagat
gggcacgcggaaaacctcgtccagtgggaaatggaggtgtgtaaactgccaagactgtcc
ctgaacggagttcgctttaagcggatatcgggaacatccatagcttttaaaaacattgct
tccaaaattgccaatgagttaaagctgtaa

DBGET integrated database retrieval system