KEGG   Gallus gallus (chicken): 423506
Entry
423506            CDS       T01006                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    423506 (AKAP5)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     423506 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 423506
NCBI-ProteinID: XP_015143367
CGNC: 51985
UniProt: E1BSS6
Position
5
AA seq 596 aa
MAKAAKEIQMENPSELETPSAGTPCPPLEEQAEKPSMLCFKKRKKSCKKGLTTKDACEGA
SAASEEKNQCISTDPGEAKASAPLRPSRGAWAALKSLTKPRRGQKSSSRKKVSSDSQVQL
EMDAEESCAQGLPRKKASTGVKMPCVRFLRGKKKPSPSEVVEESEDSVQANEVMGILNKA
IEELEDMVPAEPCDKAESLTPLPAEDVAPAEPCGRAEALSPLPAEDQGTSAEGAGAPCDK
AESLSPFLAEDMAPAEPCDKAESLSLLPAQNSAPADPCDKAESLSPLPAEDVTPAEPRGS
AEALSPLPAEDVAPAEPCDKAESLSPLPAEDQGMSAGGADADGRSEPSGEPRPDVDEHTE
CIAQSEITSSEPVNEPLQEKLPEGSPHQSAAQVENREVTPEAPVSTDQPNGTPEITEVQE
IARICKELPERDESERNTDLPEECKSEETTMDFSSSSVSKDDATSVQSSSSHQEKPEVNM
GTGVGIVITITEAVDSDDADSDQAYEPSPVLHHNKQKGNKKSSGSFDFGQKEGPGASSGA
VVEEKGLGDQGHRTSDQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcaaaggcagctaaggaaatacaaatggagaacccgagcgagctggagactcctagc
gcggggacaccgtgccccccattggaagaacaggcagaaaaaccctccatgctctgtttt
aagaagcggaagaagtcctgtaagaaggggctgacaactaaggatgcatgtgagggagct
tctgcagcctcggaggagaaaaatcaatgcatcagcacagacccaggggaggcaaaagct
tctgctccattgcgaccctccagaggagcctgggcagctctcaaaagtctcacaaagcct
cggagagggcagaaatcctcttcacggaagaaggtgtcctctgattcccaggtgcagctg
gagatggatgcggaggagagctgtgcacaaggtcttccaaggaaaaaggccagcacgggg
gtgaagatgccctgtgtgcgcttcttgagaggcaagaaaaagcccagcccctcagaggtg
gtggaggagtcagaggacagtgtccaagcaaatgaagtgatgggcattttgaacaaagcc
attgaagagctggaggacatggtcccagcagagccctgtgacaaggccgagtccctcact
ccactccccgcagaggacgtggccccagcagagccctgtggcagggctgaagccctcagc
ccgctccctgcagaggaccagggcacatcggcagaaggtgctggtgccccctgtgacaag
gctgagtccctgagcccgttccttgcagaggacatggcccctgcagagccctgtgacaag
gccgaatccctcagcctgctccctgcacaaaactcagcccctgcagatccctgtgacaag
gccgagtccctcagcccactccctgcagaagatgtgaccccagcagagccacgtggcagt
gccgaagccctcagcccgctccctgcagaggacgtggccccagcagagccctgtgacaag
gccgagtccctcagcccactccctgcagaggaccagggcatgtcagcaggaggtgctgat
gccgatgggaggagtgagccctcaggagagcccaggcctgacgtggatgaacacacagag
tgcatcgctcagtcagaaataaccagttcggagcctgtcaatgagccactgcaggaaaag
ctgcccgaggggagtccacaccaatctgcagcccaagtggaaaacagggaagtcactcct
gaagcaccggtatctacagatcagcccaatggcacccctgaaatcaccgaggtgcaggaa
atagccagaatatgcaaggagcttcctgaaagggatgagtcggagaggaacactgacctc
cctgaggagtgcaaatctgaagagaccacaatggatttcagttcatcatcagtgtctaag
gatgatgcaacgagtgtgcagagcagctccagccatcaggagaaaccagaagtcaacatg
ggcaccggcgttggcatcgtcatcaccatcaccgaagccgtggactctgatgacgctgat
tctgaccaggcctatgagccatccccggttttacaccacaataagcaaaaagggaataaa
aaatccagtgggagctttgattttggtcaaaaggaaggccccggggctagcagtggtgct
gtggtggaagagaaaggcctgggcgaccaggggcacaggacttcggatcagtacgagttg
ctcctcatagaaacggcgtcttcccttgtgaaggcggccatccagtcgtccatcgagcag
ctggtcaacgagatggctctggaacagaataaacacaacagttttctgtga

DBGET integrated database retrieval system