KEGG   Gallus gallus (chicken): 423518
Entry
423518            CDS       T01006                                 

Gene name
PRKCH
Definition
(RefSeq) protein kinase C eta type isoform X2
  KO
K18051  novel protein kinase C eta type [EC:2.7.11.13]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    423518 (PRKCH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    423518 (PRKCH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    423518 (PRKCH)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     423518 (PRKCH)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   423518 (PRKCH)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   423518 (PRKCH)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C Kinase-like C1_2 RIO1 APH Kdo
Other DBs
NCBI-GeneID: 423518
NCBI-ProteinID: XP_015143394
CGNC: 9013
Ensembl: ENSGALG00000011889
Position
5
AA seq 571 aa
MSSNIWTPQVDLEPEGKVFVVITLTGSFTEGTLQRDRIFKNLTRKRQRAMRRRVHQVNGH
KFMATYLRQPTYCSHCKEFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNTNKND
LKVTEQRFGINIPHKFSVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVA
PNCGVNSAELAKTLACMGLQPGSISPNSKLTSRSSLRHQGKGSLKDNNGVSESSASKLGI
TDLTFLRVLGKGSFGKVMLAKMKESGQLYAVKVLKKDVILQDDDVECTMTEKRILSLARN
HPFLTKLYCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEDRARFYAAEIISALMFLHE
RGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGIHDGITTATFCGTPDYIAPEILQEMLYG
PDVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLQQDAVAILKAFMTKN
PSMRLGSTALGGESAILRHPYFKELDWELLNQRQMEPPFRPRIKSKDDVSNFDPDFIKEE
PILTPIEEGILPMINQDEFRNFSFTSPELQQ
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgagcagcaacatctggacaccacaagtggatttggaaccagaagggaaagtgtttgtc
gtcattactcttaccggcagcttcacagaagggaccctccagagggatcgcatttttaag
aacctcactcggaagcgccagcgggccatgcggaggcgagtgcatcaggtgaatgggcac
aaattcatggctacctacctgcgacagccaacctactgctcacactgcaaggagttcatc
tggggtgtgtttgggaagcagggataccagtgccaagtatgcacctgtgttgtacacaag
cgctgccatcatctaattgttacagcttgcacgtgccagaacaatactaacaagaacgat
ctcaaggtgactgaacagaggtttggcatcaacatccctcataagttcagtgtccacaac
tacaaagtcccgacgttctgtgaccactgtggttccttgctctggggaattatgcgacaa
ggcctacagtgtaaaatctgtaaaatgaacgtccacatccgatgtcaagcaaatgttgca
ccaaactgtggggtgaactcagcagagcttgctaaaaccttggcatgcatgggcctgcaa
ccaggaagcatttccccaaattcgaaactgacttcaagatcttctttgagacatcaggga
aaaggcagcttgaaagataacaacggggttagtgaaagttcggcaagcaaacttgggatc
acagacctgaccttccttcgtgtattgggaaagggcagttttggaaaggtgatgcttgcc
aagatgaaagagagtgggcagctctatgcagtgaaggtgctgaagaaggacgtcattctc
caagatgacgatgttgagtgcaccatgaccgagaaacgcatcctctccttagcaaggaat
cacccattcctcaccaagctctactgttgctttcagacacctgatcgcctgttctttgtg
atggagttcgtaaacggcggggacctgatgttccatattcagaagtcacgtcgcttcgat
gaagatcgggcccggttctatgctgcagaaattatttcagcccttatgtttcttcatgaa
agaggcatcatttatcgggacttgaaactggacaatgtgctgctggaccatgagggacac
tgcaagctggcagacttcgggatgtgcaaggagggcattcacgatggcattaccacagct
accttctgcggtacaccagactacattgctccagagattctgcaagagatgctgtatggc
cctgatgttgactggtgggccatgggcgtgctgctgtacgagatgctgtgtggccacgcg
cccttcgaggcagagaatgaggacgacctctttgaggccattctgaatgatgaagttgtc
tacccaacatggctccagcaggatgcagtggcaatcctcaaagcgttcatgacgaagaac
cccagcatgcggctgggcagcacggcactgggtggtgagagcgcgatcctgcggcacccc
tacttcaaagagctggactgggagctgctgaaccagcgccagatggagccaccgttcaga
ccccgaattaaatccaaagatgacgtgagcaactttgaccccgattttataaaagaggag
cccattctgactcccattgaagaaggaattcttccgatgataaaccaggatgaatttaga
aacttttcattcacaagcccagaactgcagcaatag

DBGET integrated database retrieval system