KEGG   Gallus gallus (chicken): 423519
Entry
423519            CDS       T01006                                 

Gene name
SLC38A6
Definition
(RefSeq) probable sodium-coupled neutral amino acid transporter 6
  KO
K14993  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    423519 (SLC38A6)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   423519 (SLC38A6)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 423519
NCBI-ProteinID: XP_421418
CGNC: 9015
Ensembl: ENSGALG00000011893
UniProt: E1BXH7
Position
5
AA seq 466 aa
MEALPRGAQRGWYLSARRQRDCGQGEDGDDDSEEDGETAPLLPAASGRGSSQRGSSFGLS
VFNLMNAIMGSGILGLSYAMAGTGVLGFSALLLMVASLASYSVFLLLSMCTQTAVTSYED
LGLFAFGSAGKVLVATTIIIQNIGAMSSYLLIVKSELPGAVAGFLSGDGSGSWYLDGRLL
LLITSVCIVFPLALLPKIGFLGYTSSLSFFFMVYFALVIMIKKWSIPCPLPLGSAIETLQ
VSNSTADCKAKLFHLSKESAYAIPTMAFSFLCHTSVLPIYCELQSPSKSRMQNVAVTGIG
LSFIIYFMSALFGYLTFYDKVDSELLRGYSRYLPHDTVIMTVKLAILFSVLLTVPLIHFP
ARKAVFLVFFSHLPVSWICHILVTLVLNAIIVLFAMYVPDIKNVFGVVGSTTSTCLLFVY
PGLFYLKLSREDFLSPHKLGACALVIFGICVGLLSLVLIILNWINQ
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggaggcgctgccgcggggggcccagcggggctggtacctgtccgcccggcggcagcgg
gactgcggccagggggaggacggcgacgacgatagcgaggaggacggggagaccgctccg
ctgctcccggcggcgtcgggcagaggctcctcgcagcgcggctcttccttcggcctctcc
gtgttcaacctcatgaacgcgatcatgggcagcggcatcctcggcttgtcctacgccatg
gccggcacgggggtcctgggcttcagcgccctgctgctgatggttgccagcctggcgtct
tactccgtgttcctcctgctcagcatgtgcacgcagaccgctgtcacttcctatgaggac
cttggcctgtttgcgtttggatcagctggaaaggtccttgttgcaactacaataattatc
cagaatataggagctatgtcatcttatctgttaattgtgaagtctgagcttcctggtgct
gttgcagggttcttaagtggagacgggagcgggtcctggtaccttgatgggagactgctg
ctactcattacttcggtctgcattgtatttcccctcgcgcttcttcctaaaatcggcttt
cttggctacacaagtagtttatcatttttctttatggtgtactttgcgcttgtgattatg
ataaaaaaatggtccatcccttgtcctctacctctgggcagtgcaatagagaccttacag
gtttcaaattctactgcggattgtaaagcaaagctctttcatctttcaaaagagagcgct
tatgcaataccaaccatggccttctcttttctctgccatacctcagtcttaccgatttac
tgtgagctccaaagtccatccaaaagtagaatgcagaatgtagctgtcacaggaattggc
ctgagtttcataatttactttatgtctgctttgtttgggtatctgacattttatgacaaa
gtggactctgaattgctgcgaggttacagcaggtacctgccacatgatactgtcatcatg
actgttaaactggccatactgttctccgtgcttctgacagtccctctcatccacttccca
gcgaggaaagccgtattcctggtgttcttctctcaccttcctgtgtcttggatttgccat
attcttgtcactttagtgctgaatgcaatcattgttctgtttgcaatgtatgtgccagac
attaaaaatgtattcggagtagttggttcaaccacatcgacgtgtttgctttttgtgtat
cctggactgttttatcttaaacttagcagagaggacttcctgtcaccacacaaacttggg
gcatgtgcattggttatttttggcatttgtgttggtctgctcagtttagttctaataatc
ctcaattggattaatcagtaa

DBGET integrated database retrieval system