KEGG   Gallus gallus (chicken): 423551Help
Entry
423551            CDS       T01006                                 

Gene name
TMEM260
Definition
(RefSeq) transmembrane protein 260 isoform X2
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2723
Motif
Other DBs
NCBI-GeneID: 423551
NCBI-ProteinID: XP_004936532
CGNC: 9190
Ensembl: ENSGALG00000012118
Position
5
AA seq 674 aa AA seqDB search
MKLPQTWHFQDSRELITAAYELGVAHPPGYPLFTLLAGLAMRLLPGGAAAGRVNLLCAVL
GAAAAALLFYTVLRLSGSYAGGILAAGVFSFSRLTWQWSITAEVFSLNNLFVGLLMALTV
HFEEASTAKERSKIARLGAFCCGLSLCNQHTIVLYIACIVPWVLFLLFRKMELSLGHLLK
LGLCFLAGLLPYLYLPASSYLNRARWTWGDQTTFQGFLTHFLREEYGTFNLAKSESGSSM
REMLVFQLEQMRSELSLPVLVLALIACFSTALPIKQQKSPVICLFAGMLCVYSLFFAWRA
NLDVTKPLFLGVVERFWMQSNVAVAVLAGLGLAALMSLGGAVLQGSRVLPWLEWLSAGAL
VAAQVWANYRDCDQSNNYIVDKFARNLLSSMPMGAVILLRGDLPGNALRYLHYVEGVRPD
ITLVDQEMMTYEWYLPKLAKHLPGVHFPGNRWNPVEGILPDGTLVFNLHHFLKANKHKEV
FVCIGLHEGDSTWRRSYSLWPWGTCEKLVPTDAVFDPGEWIRLTRNLYNWTEEYGSFKPS
SWEAVANEEMWQARMKTAFFIFGLAETASVPAEMKSQLYTLAYTLYKEIVSSHPHHPVNW
HKNYAIACERMLRLHRVGEDPEVLLSETVKHFLLYTQKAEDDPQRQDILQAVNHLQKELQ
GLRGMKAELKRQAG
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcctcaaacttggcacttccaagacagcagggagctgatcacagccgcatat
gagcttggagtcgcccacccgcccggctaccctctattcacgctgctggccgggctggcc
atgaggctgctgcccggcggggccgctgcgggccgtgtcaacctgctgtgtgctgtgctg
ggagctgcggcagctgcgctgctcttctacaccgtgctcaggctttctggctcatatgct
ggaggaatccttgctgcgggggtgttttcattttctcgtctaacatggcagtggtccatc
acggcggaggtttttagcttaaacaatctgtttgtggggctgcttatggctcttaccgtg
cattttgaggaggcatccactgcaaaagagagatcaaagatcgccagacttggtgccttt
tgctgcggcctcagtttgtgcaaccagcacacgatagtgctttatattgcttgtattgta
ccttgggttctcttcctgctcttcagaaagatggaattgtccctaggccatttgctgaag
ttgggtttatgcttcttggctggtttgctgccttatctctatctgccggcttcgtcctac
ctcaatcgagcccgttggacatggggagaccagacgacttttcaaggatttttgacccac
tttctcagggaggaatatgggacattcaatctggccaagtccgagtccggatccagtatg
agagagatgttggtcttccagctggagcagatgaggtcggagctgtcccttcctgtcctt
gtcctggcactcatcgcctgtttcagcacagcactgccgataaagcaacagaaatcacct
gtgatttgtctcttcgctggaatgctctgtgtttattcactcttctttgcctggagagca
aatttggatgttacaaagcctctgtttctgggagtggtggagcggttctggatgcagagc
aatgtggctgtggcagtgctggcaggactggggctggctgctctcatgtcccttggaggt
gctgtgctgcagggcagccgggtgttgccatggctggagtggctttctgctggggctctc
gttgctgctcaagtttgggccaactatagggattgtgatcagagcaacaattacattgtt
gacaagtttgcaagaaacctgctgtcctctatgccaatgggtgcagtgattttgctaaga
ggagacttacctgggaacgcccttcgttacctgcattatgttgaaggagtgaggccagat
atcacattagtggaccaagagatgatgacttatgaatggtatttacccaagctggcaaag
catttacctggtgttcattttcctgggaaccggtggaaccccgtggaaggaatattaccc
gatgggacacttgtttttaatctccaccatttcctcaaagcaaataaacataaagaagtg
tttgtctgcataggtcttcatgaaggggattcgacctggaggaggagttactcgctttgg
ccatggggtacctgtgaaaagttggttcctactgatgctgtctttgacccaggagagtgg
attcgtctgacaagaaatctctataactggactgaagagtatgggagtttcaagccctct
tcctgggaagctgtcgccaatgaggagatgtggcaagccaggatgaaaacagctttcttt
atatttggccttgcagaaactgccagcgtgcctgcagaaatgaaatcacagctgtacaca
ttggcatacactttgtacaaagaaattgtcagctctcatccacatcacccagtgaactgg
cacaaaaactacgcgatagcctgcgagaggatgttgcgtctccatcgggtgggtgaggac
cctgaggtgttgctctctgaaaccgttaaacatttcctcctctacacccagaaagcagag
gatgatccccagcggcaggacattctacaggctgtgaaccacctccagaaggagctgcag
gggctgaggggaatgaaagctgagctgaagcggcaagctggatag

DBGET integrated database retrieval system