KEGG   Gallus gallus (chicken): 423609
Entry
423609            CDS       T01006                                 

Gene name
OPN4
Definition
(RefSeq) melanopsin
  KO
K04255  r-opsin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    423609 (OPN4)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Vision
   Opsin
    423609 (OPN4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv Git3 SNARE 7tm_4
Other DBs
NCBI-GeneID: 423609
NCBI-ProteinID: NP_001038118
CGNC: 52000
Ensembl: ENSGALG00000001934
UniProt: Q2KNE6
Position
6
AA seq 528 aa
MDLPPRAPTKMTVKDVRGAFPTVDVPDHAHYTIGTVILIVGITGTLGNFLVIYAFCRSRT
LQKPANIFIINLAVSDFLMSITQSPVFFTNSLHKRWIFGEKGCELYAFCGALFGITSMIT
LMVIALDRYFVITKPLASVRVMSKKKALIILVGVWLYSLAWSLPPFFGWSAYVPEGLLTS
CSWDYMTFTPSVRAYTMLLFCFVFFIPLIAIIYSYVFIFEAIKKANKSVQTFGCKHGNRE
LQKQYHRMKNEWKLAKIALIVILLYVISWSPYSVVALVAFAGYSHVLTPFMNSVPAVIAK
ASAIHNPIIYAITHPKYRTAIATYVPCLGFLLRVSPKESRSFSSYPSSRRTTITSQSSET
SGLQKGKRRLSSISDSESGCTDTETDITSMISRPASSQVSYEMGEDTTQTSDLGGKPKVK
SHDSGIFGKAVVDADEIPMVEINDTEHSATSTCKTSEKCNVEEIQRSESLSGIGLREGES
RRRTSASQIPSIIITYSNVQGVELPSGYSAGFLHPKNKSHIQNKSSNS
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggacctgcctcctagagccccaacaaagatgacagtgaaagatgttcgtggtgctttt
cctacggtggacgtcccagaccatgcccattatacaattggaacagtcattcttatcgtg
gggatcacaggaactctgggtaatttcctggtcatctatgctttctgcaggagtaggacc
cttcagaaaccagccaatatattcatcatcaatctagctgttagtgacttccttatgtcc
attacacagtctccagtatttttcaccaacagtctccataaacgttggatttttggtgag
aaaggctgtgagctgtatgccttctgcggagctctttttggcattacatccatgatcact
ttgatggtgattgccttggacagatactttgtcatcacaaaacctctggcttctgttcga
gtgatgtcaaagaagaaggcccttataatcctggtaggcgtctggctgtactctttggct
tggagcctcccacccttctttggatggagtgcctatgttcctgaaggcctgctgacttcc
tgttcctgggattacatgactttcacaccatcagtccgtgcctacacaatgctgcttttc
tgctttgtcttcttcattcctttgattgctatcatatacagctatgtctttatatttgag
gctatcaagaaggccaacaagtctgtacagacatttggttgcaaacatggaaacagagag
ctccagaaacagtatcataggatgaagaatgagtggaagttggccaagattgcactgatc
gtcatcttgctttatgtcatttcctggtcaccatactctgttgttgccctggtagctttt
gctgggtattctcatgtactaacacctttcatgaattcagtaccagctgtgattgccaaa
gcttctgccatccataaccccattatttatgccatcactcaccctaaatatagaacagcc
attgcaacatatgtaccctgccttggattcctgctgagagtttctcctaaagagtcacga
tcctttagcagttatccctcctccagacgaaccaccataaccagccagtcttctgagaca
agtgggctgcagaaaggaaaaaggcgactatcttccatctctgatagtgaatcgggctgt
accgatacagaaactgatatcaccagtatgatctccagacctgctagcagccaggtttcc
tatgaaatgggggaagatacaacccaaactagtgacctaggaggcaaacctaaagtgaaa
agccatgattctgggattttcgggaaggcagttgtagatgcagatgaaatacccatggtg
gaaatcaatgacacagagcattctgctacatctacttgcaaaacatctgaaaaatgcaat
gtggaggaaattcagagaagtgagagcctgagtggtattggactaagagaaggagagtct
cgccgtagaacatccgcatctcagatacccagcattataataacatacagcaatgtacaa
ggagtagagctgccttcaggatacagtgctggcttcctgcacccaaagaacaaaagccac
atacagaacaagagctccaacagctga

DBGET integrated database retrieval system