KEGG   Gallus gallus (chicken): 423619
Entry
423619            CDS       T01006                                 

Gene name
RGR
Definition
(RefSeq) RPE-retinal G protein-coupled receptor
  KO
K04254  retinal G protein coupled receptor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    423619 (RGR)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Vision
   Opsin
    423619 (RGR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 423619
NCBI-ProteinID: NP_001026387
CGNC: 52006
Ensembl: ENSGALG00000002299
UniProt: Q69FK2
Position
6
AA seq 295 aa
MVTSHPLPEGFTEIEVFAIGTALLVEALLGFCLNGLTIISFRKIKELRTPSNLLVLSIAL
ADCGICINAFIAAFSSFLRYWPYGSEGCQIHGFQGFLTALASISSSAAVAWDRYHHYCTR
SKLQWSTAISMMVFAWLFAAFWATMPLLGWGEYDYEPLRTCCTLDYSKGDRNYITFLFAL
SIFNFMIPGFIMMTAYQSIHQKFKKSGHYKFNTGLPLKTLVICWGPYCLLSFYAAIENVM
FISPKYRMIPAIIAKTVPTVDSFVYALGNENYRGGIWQFLTGQKIEKAEVDSKTK
NT seq 888 nt   +upstreamnt  +downstreamnt
atggtcacttcacatcctctccctgaaggcttcactgaaatagaggtgtttgccatcggc
actgccctactggtagaagccctgcttggtttctgtctgaatggcttgacgattatttca
ttccgaaaaatcaaagagctccgaacacccagcaacctgctggttctcagcatcgcactg
gctgactgcgggatatgcatcaatgcattcatcgctgccttttccagcttcctcaggtac
tggccctatggctccgagggctgtcagattcatggattccagggcttcttgacagcacta
gccagcatcagctccagcgcagcagttgcctgggaccggtatcatcactactgtacaagg
agcaagctgcagtggagcacagccatctccatgatggtgttcgcgtggctgttcgctgcc
ttctgggccacaatgcccttgctgggctggggggagtatgactatgagcccctccgaacc
tgctgcaccctggactacagcaaaggggacagaaactatatcacattcctttttgctctg
tccattttcaatttcatgatcccgggcttcatcatgatgacggcctatcagtccatacat
cagaagttcaagaaaagtgggcactataagtttaacactggcttaccgttgaagacgctg
gtcatttgctggggtccctactgccttctgagtttctatgcagcaattgaaaacgtgatg
ttcatttcaccaaaataccgaatgattcctgccattattgccaagacagtgccaaccgtg
gacagctttgtgtatgccctgggcaatgagaactacagaggaggaatatggcagttcctc
acaggacagaagattgagaaagcagaggttgatagcaaaactaagtaa

DBGET integrated database retrieval system