KEGG   Gallus gallus (chicken): 423644
Entry
423644            CDS       T01006                                 

Symbol
PCDH15
Name
(RefSeq) protocadherin-15 precursor
  KO
K16500  protocadherin-15
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    423644 (PCDH15)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    423644 (PCDH15)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    423644 (PCDH15)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Protocadherins
   423644 (PCDH15)
SSDB
Motif
Pfam: Cadherin ECD RET_CLD1 DUF3149
Other DBs
NCBI-GeneID: 423644
NCBI-ProteinID: NP_001038119
CGNC: 52015
Ensembl: ENSGALG00000002744
UniProt: Q0ZM14
Position
6
AA seq 2192 aa
MLQQFCLWKWLAVGIAVATILASSLAQNDEDCKLARTGPPATIVPIDEESRNGTILVDNM
LIKGTAAGPDPTIELSLKDNVDYWVILDPISQRLYLNSTGRVLDRDPPMSIQSIVVQVQC
VNKKVGTIINHEVRIVVRDRNDNSPQFQQQRYYVAVNELTPVGTTIFTGFSGNNGATDID
DGPNGQIEYVIQYNPNDKTSNRTFDIPLTLSGAVVLRERLNYEEKTRYFVIVQANDRAQN
LHERRTSTTTLTVDVLDGDDLGPMFLPCVLVNNTRDCRPLTYQASLPELTDPVHVNPISV
TPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPQYFHMNLTTAELTLLKPINRDLHQK
FDLVIKAEQDNGHPLPAFANLHIEVLDENNQKPYFTKSTYEGFILESSPVGTTISDSRNL
TSPLQITVLDNDVEETKDPQLHLFLNDYNTFFTVTQSGITRYLTLLQPVDREAQQLYTFS
MIASDGVQESTPVTVNIVVIDANDNSPTFSNISYNVKIYTDMGPGEGVIKLTAVDADEGP
NGQIVYEILAGDQGDFIINDRTGLIAIAPGVVLSVGRSYALTVKASDSAPPAQRRSSITT
VYIEVLPPNNQSPPRFPQLMYSLEVSEAMRTGAILLNLQAFDREGDPIRYLIENGDPQQV
FNLSQSSGLLALGKPLDRESTDRYILIVTASDGRPDGTSTATVNIVVTDVNDNGPVFDMF
LPKNLSVQEEEANAFVGQVRATDPDAGVNGQVHYSLANFKNLFRITSNGSIYTAVKLNRE
VRDYYELIVEATDGAVDPRRSTLTLAIKVLDIDDNSPVFTNASYSVLVPENLPPGTVFLQ
IEAKDVDLGSNVTYRIRTQEALEYFALNKYTGELSLLKSLDYESFSDTDATFTFLVEAFD
SKGTMPPGLATVTVRVKDMNDYSPVFSKTLYRGMVAPDAVKGTVITTVSAEDQDPPGTPA
SRVRYKVDVVQFPYSASIFDVEENSGRVVTRVNLNEEPSTVFKLVVIAYDDGDPVKFNTT
TVEIAVLQPSVIPRFTQDEYRPPPVSESAPKGTVVTVVMAAALNQTIVYSIVSGNEEDVF
AINNRTGVISVKKPLDYERVTSYELRVQADSLQVVRSNLRVPSKSNTAKVFIEVKDENDH
APVFTKKMYIGGVSEDAKMFSSVLKVKADDKDTGNYSAMQYRLIIPPIKDGKEGFVIEAY
TGLIKTAMLFKNMRRSYFKFQVIATDDYGKGLSSKADVLVSVVNQLDMQVIVSNVPPTLV
EQNKDQLIGILERYVQDQIPGATVVVESIGARRFGDGYSEEDYTKSDLMVYAIDPQTNRA
IMRNELFKFLDGKLLDINKEFQPYLGQGGRILEIRTPDVVANVKKQAQAVGYTEGALLAL
AVIIILCCMPAILIVMVSYRQRQAECAKTARIQMALPAGKPASTAANNLYEELGDSTMRG
YAQQEQQQLLRPSLLRPEELSMESGIDPGQEYYGQDYYSYEHGYELPQYGSRRRLLSPSG
MYDEYGEVMVENDGGYYYSPHGSTAEEGMSQSRGPSSRGISQRAGAQIEGRPLDGGMDLR
HGSGRAYRTSQGRRKLKAVMHLSRVAVSAHKPVGRSESAHSPWKKAKIFPMILQKVKGSR
KDSSYAKLMSARQADGEKSMIIRGSYFQKSTDDRPSMRKLNHVLKRISVSRKFQEPTSKD
AVHLGGKEEEERDEAKSGVSISITAESEHEESDYEKKKKRRRKYSSDESSAKSSSSGSES
EDKDYLTVTLDQDEATESTVDSDEESGHDIGDSDDGSGSSSSSESEEDSSEEDSDEEESD
SDEDDSLSQSSSTQSSFSKSGTSESSSRRSTGRSSTKSRGSSSRGRARRSSQKSVSSNTS
GASCRKTSGSSYKSKTSSASLEIEDTIEEVSEEDEQADAEQVGASPDETIDNTKNKTVSK
TSANAKSAKNAATEEDKRRKSGVNSGDNGDESAEEVDTDASDKEETVSKNGSEISVTSKG
TGGIKSTASATSGRTATSPDTETQSSDINWARKKRIKLIVDPEYETSSTGEDSAPDSSQR
SRLNNPNIQNNVNGNIYIAQNGSVVRTRRVCLANNLKVTSPVTLGKQFKKLDKLAVTHEE
NVPLNTLSKGSSSSDKVNTRPCSVSFASSIGAENIVTKPGGSKMKSTEEQESVVDNEDTK
EPLESHSEHTQSDEEELWMGPWNNLHIPMTKL
NT seq 6579 nt   +upstreamnt  +downstreamnt
atgctacagcagttctgtctctggaagtggttagctgtagggattgccgtggctactatc
ttagcaagttccttggcccaaaatgatgaagattgcaagttggccagaacaggtcctcca
gccacaatagttcccattgatgaagagagtcggaacggcactatcctggttgacaatatg
ctgatcaaaggaacagcagcggggccggaccccaccattgagctctccttaaaggacaat
gttgattactgggtgatccttgatcccatcagccagaggttgtacttaaacagcactggc
cgagttctggacagagatcctccaatgtccatccagtccattgtggtacaagtccagtgc
gttaacaaaaaggttggcaccattatcaaccatgaggtacggattgtggtgagagacagg
aatgataactcacctcagttccagcagcagcgatactacgtggcagtaaacgagttgact
ccagttggaacgaccatctttacaggattttctggaaacaatggtgctaccgacatcgat
gatggtccgaatggccagatagagtatgtcatccagtacaatcctaatgacaaaacttcc
aacaggacctttgatatccctctcactttgtctggagcagtagttctacgggagagacta
aattatgaggaaaagactcgttactttgtgattgttcaagccaatgaccgagctcagaat
cttcatgagcgaaggacaagtacaaccaccctcacagtggatgtgctggacggggatgac
ctgggaccaatgtttcttccttgtgtcttggtgaataatactcgtgactgtagacctctc
acctaccaagcaagcttgccagaactgactgatcctgtgcatgtgaaccctatcagtgtc
actccacccatacaagccatagatcaagaccgaaacatccagcctccttctgatcgaccg
ggcatcctctattccatcctcgttggtactcccgaggattatccacagtatttccatatg
aacctcacaacagctgaactcacgctcttgaagccaataaacagggatttgcaccagaag
tttgacttggttattaaggctgaacaagacaatggccatcctcttcctgcctttgccaat
ttacatattgaagtccttgatgagaacaatcagaagccttacttcacaaaatctacatac
gagggctttatccttgaatcctccccagtgggaacaaccatctcagatagccggaatctg
acctctccattacaaatcacggtgttggacaacgatgttgaggagaccaaggacccccag
ctccatctcttcctgaatgattacaatacgtttttcactgtgacccagagtggcatcacc
cgctacctcaccctgctgcagccggttgacagagaagcccagcaactctacaccttctcg
atgatagcttctgatggcgtacaggagagtaccccagtgacggtcaatattgtggtgatt
gatgcaaatgataattccccaaccttctccaatatatcttacaatgtcaagatttacaca
gatatggggcctggggaaggcgttataaagctcactgctgtagatgcggacgagggaccc
aatggacagatagtgtatgaaattttggctggggatcagggagacttcatcatcaatgac
cgaacaggccttatcgccattgctccaggagttgtattgtcagtggggcgatcctatgct
ctcactgtcaaagcatctgatagcgctcctcctgcacagagaaggagctctattactaca
gtttatatcgaggtccttccacccaacaaccagagccctccccgcttcccgcagctgatg
tacagcctggaagtcagtgaggccatgaggactggagccattttgttaaacctgcaggct
tttgatagagagggtgaccctataagatacctcattgagaatggagatccgcaacaagtt
tttaatctctctcaaagttctggactgctagccttaggaaagcccttggacagagaaagc
actgatcgttatattctgatcgttacagcctcggatggcagaccagatgggacttcaact
gctacagttaatattgtggtgacggatgtaaatgacaatgggccagtttttgatatgttt
ctacctaaaaacctgtctgtacaggaagaggaagccaatgctttcgttggtcaagtaagg
gctacagacccggatgctggtgttaatggtcaagttcattacagtctggcaaacttcaag
aatctttttcgaatcacttcaaatggcagcatatacacagcagttaagctgaacagagaa
gtacgagactattacgaacttattgttgaagcaacagatggagctgtggaccctcgccgt
tcaacactaactttagcaatcaaggtgctggatattgatgacaacagccctgtttttaca
aatgcttcctactctgtcttggtgcctgaaaatctaccacccggcactgtcttcctgcag
atagaggcgaaagatgttgatcttggttctaatgttacctatcgaatccggacgcaggag
gcactggagtattttgcactgaacaagtatacgggcgagttatcacttctgaagtccttg
gattatgagtcattctctgacacagatgcaactttcaccttccttgtggaagccttcgac
agcaagggcactatgcctccaggtcttgctaccgtcacagtgagggtaaaggatatgaat
gattactcgccggtatttagcaagacgctctacagaggaatggttgctcctgatgctgtc
aagggcactgttatcactaccgtttcagctgaggatcaagatcctccgggcacaccagca
agccgagtccggtacaaagttgacgttgtccagtttccttacagtgccagcatttttgat
gtggaggaaaactcaggacgtgtagtaactcgggtaaacctaaatgaagagccaagtaca
gtgttcaagctagtggtcattgcatatgatgatggagatcctgtgaagttcaataccact
actgtagaaattgctgtacttcaaccttcggtaatcccacggttcacgcaggacgaatac
agaccccccccagtaagtgaaagtgcaccaaaaggaactgtggtcactgtggtgatggca
gctgccttgaaccaaactatcgtatattcaatagtgtcaggaaatgaagaggatgtgttt
gctattaataacagaacaggcgtgatctccgttaaaaagcctctggattatgaaagagtg
acaagttatgaacttcgagttcaggcagactcgttacaagtggtacgatccaacctgcgt
gtcccatccaaaagtaatacagccaaagtgttcattgaagtgaaggatgaaaacgatcat
gcgcctgtctttaccaaaaaaatgtacattggaggagtgtctgaagatgctaaaatgttt
tcttctgtgcttaaagttaaggctgacgataaagacactgggaattacagtgccatgcag
tacaggctcatcattcctccaatcaaggatggtaaagaaggttttgtgattgaagcttac
acagggctaataaaaactgctatgctgttcaaaaatatgagaagatcctatttcaagttt
caggtcattgcgactgatgattacggaaaaggactgagcagcaaagcagacgtactcgtc
tctgtggtcaatcagttggatatgcaagtcatcgtctctaatgttcctcccacccttgtg
gaacaaaacaaagatcaactcatagggattctggaacgctacgtccaagatcagattcct
ggtgcaactgtcgtggtggaatccattggcgcacggaggtttggggatggatactccgaa
gaggattataccaagtctgacctcatggtctacgccattgacccacaaacaaatagagcc
ataatgaggaatgaactttttaagttcctcgatggcaaactgctggatatcaataaagag
tttcagccatacctgggacaggggggacgcatcctggagatccgcaccccggacgtggta
gcaaatgtcaagaagcaggcgcaagctgtgggctacacagaaggtgcattgctggccctg
gccgtcattatcatcctgtgctgtatgccagctattttaatagtcatggtcagctacaga
cagcgacaggctgagtgtgctaagactgcaagaatccagatggccctaccggcaggcaaa
ccagcaagcactgctgccaataacctctacgaagagcttggtgacagcaccatgcgagga
tatgcacagcaagagcaacagcagttgctgagaccttcccttctcagaccagaggagtta
agtatggagtctggaattgatccagggcaggaatactacgggcaagattactacagttat
gagcatgggtatgaactgcctcagtatgggagccgccgccgcttgctgtctccttcgggg
atgtatgatgagtatggggaagtcatggtggagaatgatggcggctactactatagtcca
catggatcaacagcggaagagggaatgagtcaaagcagaggtccttcgagcagaggtata
agccagagagcaggggctcaaatagaaggtagacctttagatggtgggatggatctaagg
catggctctggaagagcatatagaaccagccagggaaggagaaaactaaaagcagtgatg
catttaagtcgtgtagcagtcagtgctcacaaaccagtaggaagaagtgagtctgctcat
tctccgtggaagaaagcaaagatattcccaatgattctgcagaaagtgaaaggcagtagg
aaggattccagttacgccaagttgatgtcagctcgccaggcggatggtgagaaaagcatg
attatcaggggaagctacttccagaaatcaacagatgacagaccttcaatgagaaagcta
aatcatgtgttaaaacgcatcagtgtctccagaaaatttcaagagcctactagcaaagat
gcagtgcatttgggaggaaaagaagaggaagaaagagatgaagcaaagtcaggagtttca
ataagtatcacagcagagagcgaacatgaggaaagtgattatgagaagaagaagaagagg
agaagaaaatacagctcggatgagtcctccgcgaagagtagtagctctgggtcagagtca
gaagataaagactatttgacagtaactctggaccaagatgaagccactgaaagtaccgtg
gactccgatgaggaatctgggcatgatatcggggattccgatgatggctctggatccagc
tctagcagtgaatcagaggaggactcttctgaagaggacagtgatgaggaagagtctgac
agcgatgaagacgatagcctgtcacagagctcatctacacaaagttcattcagcaaatcg
ggaactagtgagtccagcagtagaagaagtactggaaggtcaagtacaaaaagtagggga
agtagctctcgtggcagagcaaggcgatccagccagaaatcagtcagctcgaacacatca
ggtgcaagctgcaggaaaacatcgggatccagctacaagagcaaaacctcctctgccagc
cttgaaatagaagacacgatagaagaggtttcggaagaagatgagcaagcagacgcggag
caagtcggtgcaagccctgatgagacaatagataacacaaagaataagacagtttctaaa
acatctgcaaatgcaaaaagtgctaaaaatgctgctacggaagaagacaagagaagaaag
tcgggtgttaacagtggggataatggggatgaaagcgcagaagaggttgatacagatgct
agtgacaaggaggaaactgtcagtaagaacggaagtgaaatcagtgttacctccaaaggt
actggagggataaaaagcacagctagtgccacttctggcagaactgctacttcccctgat
actgagactcagagttctgacatcaactgggccagaaagaaaaggatcaagttgattgtt
gacccggagtatgagaccagctctactggagaagacagcgctcctgattccagccagagg
agtcgtcttaataaccccaatattcaaaacaatgtcaatggtaacatctacattgcacag
aatggctctgttgtcagaacccgtcgtgtttgccttgctaataatttaaaagtgacatct
ccagtgacgctgggtaaacagttcaagaaactggacaagcttgcagtgacacacgaggag
aatgtcccactgaacacattgtcaaagggatcatcttctagtgataaagtgaacacaaga
ccttgtagtgtctcatttgcttcctctataggggctgaaaacatagtaacgaagccaggt
ggctccaaaatgaaaagcacagaagagcaagaatctgttgttgataacgaggacacaaaa
gagcccttggagtctcacagtgaacacacacagtcagatgaagaggaactctggatgggc
ccttggaataaccttcacataccaatgacaaaactgtga

DBGET integrated database retrieval system