KEGG   Gallus gallus (chicken): 423656
Entry
423656            CDS       T01006                                 

Gene name
NRBF2
Definition
(RefSeq) nuclear receptor-binding factor 2
  KO
K21246  nuclear receptor-binding factor 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    423656 (NRBF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    423656 (NRBF2)
Membrane trafficking [BR:gga04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    423656 (NRBF2)
SSDB
Motif
Pfam: NRBF2 NRBF2_MIT MIT DivIC bZIP_1 YabA HALZ ZapB VRR_NUC DUF5694 DUF5101
Other DBs
NCBI-GeneID: 423656
NCBI-ProteinID: NP_001186462
CGNC: 2138
Ensembl: ENSGALG00000002959
Position
6
AA seq 298 aa
MCPQPPPSMEVMEGPLNLAHQQSRKADRLLAAGKYEEAISCHRKAAAYLTEAMKLTQSEQ
AQLSLELQRDSHMKQLLLIQERWKRAKREEKMKAQQNADKELAAHLQTSFKPSAEESDDQ
NVLIPVTQKYSPSTEKHLQDIQGVFDRDPDTLLFLLQKKNEPVETCIGSKAPKDDKTIIE
EQATKIADLKRHVEFLVAENERLRRENKQLKAERARLQKSPVEKELDVDADFVEKSELWG
LQQHSETASSAASWQDFATTAGKAKDIPIPNLPPLDIPSPELPLLELSEDMLKGLMNS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtgcccgcagcccccaccgtccatggaagtgatggaggggcccctcaacctggctcac
cagcagagcagaaaagcagaccgcttgttggcagcagggaaatatgaagaagccatttct
tgtcacagaaaagctgccgcataccttacagaagctatgaagctgacccagtcagagcag
gctcagctatcactggaattacaaagggatagtcacatgaaacagttactgctcatccag
gagaggtggaaaagggcaaagagagaggaaaagatgaaagctcagcagaatgcggacaaa
gaattagctgcacatcttcagacttcttttaagccatcagctgaagaatctgatgatcaa
aatgtgttgattcctgtgacccagaaatacagcccttccacagagaagcatctacaggat
attcagggtgtctttgacagggacccggatacactgttatttctgcttcagaaaaaaaat
gagccagtggaaacatgtattgggagtaaagctccaaaagatgacaaaacaataatagaa
gagcaggcaaccaaaattgcagatttaaagcggcatgtagaatttctggtagctgaaaat
gagagattgagaagggagaataagcagttaaaagcagaaagagcgagactccaaaaatct
ccagtagagaaggagttggatgtagatgctgactttgtagagaagtcagagttgtggggt
ctgcagcaacactcagaaactgcttcttcagctgcatcttggcaggactttgcaacaact
gctgggaaggcaaaggacattccaatacccaaccttccccctctggacatcccatcccct
gaactccctctgctggaactctctgaagatatgctgaaaggactgatgaatagttaa

DBGET integrated database retrieval system