KEGG   Gallus gallus (chicken): 423678
Entry
423678            CDS       T01006                                 

Gene name
PAPSS2
Definition
(RefSeq) bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 isoform X3
  KO
K13811  3'-phosphoadenosine 5'-phosphosulfate synthase [EC:2.7.7.4 2.7.1.25]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga00450  Selenocompound metabolism
gga00920  Sulfur metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    423678 (PAPSS2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    423678 (PAPSS2)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    423678 (PAPSS2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    423678 (PAPSS2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     423678 (PAPSS2)
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     423678 (PAPSS2)
SSDB
Motif
Pfam: APS_kinase ATP-sulfurylase PUA_2 AAA_33 AAA_18
Other DBs
NCBI-GeneID: 423678
NCBI-ProteinID: XP_004942049
CGNC: 2698
Ensembl: ENSGALG00000003689
Position
6
AA seq 650 aa
MNSSDVRPQLTHHGSPAAVHEVGRGHGEKKEGSPSRLENVQGSTNVVYQAHHVSRSKRGQ
VVGTRGGFRGCTVWLTGLSGAGKTTIGFALEEYLVSHGIPCYSLDGDNVRHGLNKNLGFS
AGDREENIRRIAEVARLFADAGLVCITSFISPFSKDRQNARKIHEAAGLPFFEIFVDAPL
NICESRDVKGLYKKARAGEIKGFTGIDSDYEKPESPDLVLKTNIASVSECIQQVVELLQT
QNIVPCASVKDVFELFVPKNKLDAARAEANALPSVEITKLDLQWVQVLSEGWATPLKGFM
REAEYLQVIHFGTLLNGKNLSVADGVVNLSIPIVLPISAQDKQRLEGCGALALSYAGRRV
AILRDPEYFEHRKEERCARIWGTTCAKHPHVKMVMESGDWLVGGDLVVLEKICWNDGLDQ
YRLTPLELKQKFTEMNADAVFAFQLRNPVHNGHALLMQDTRRQLLQRGYKNPVLLLHPLG
GWTKDDDVPLEWRMKQHAAVLEEHVLDPKSTVVAIFPSPMLYAGPTEVQWHCRARMIAGA
NFYIVGRDPAGMPHPETKKDLYEPTQGGKVLSMAPGLTSVEIIPFRVAAYNKVKRAMDFY
DPKRHDDFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTEYYQSLEKKN
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgaattcttctgatgtcagaccccagctaactcaccatggcagtccagcagctgtacac
gaggttggacgtggccatggggagaaaaaagaaggttctccttccaggctggaaaatgta
cagggatcaaccaatgtggtttaccaagcccatcatgtcagcaggagtaagcgaggacag
gttgtcggtaccaggggtggattccgtggctgcacagtttggctaacaggcctttctgga
gccggtaagacaaccattggctttgctctggaagagtacttggtctctcatggcatcccc
tgctattccctggacggcgataatgttcggcacggcttgaataaaaacctgggcttctca
gccggggaccgcgaggagaatatccgccgcatcgcagaggtggccaggttgtttgctgat
gctgggcttgtctgcataactagcttcatttctcctttttcaaaggatcgtcagaatgca
cggaaaattcatgaggctgctgggttgcctttctttgaaatctttgtagatgctcctcta
aatatttgtgaaagcagagatgtgaagggcctgtacaaaaaggcaagagccggagagatc
aaaggattcacagggattgactcagactacgagaagcccgaatctcctgacctggtgctg
aagacaaacattgcgtcagtgtctgaatgcatccagcaggtcgtggagctcctgcaaaca
caaaacattgtgccctgtgcatcagttaaggacgtttttgagctgtttgtacccaaaaat
aaacttgatgctgcccgagctgaagcaaatgcactgccgtccgtggagatcacaaagctg
gatctgcagtgggtgcaagtgctgagcgaaggctgggccacgccactgaagggcttcatg
cgcgaggcagagtacctgcaggtcatccattttggcacgctgctgaacggaaagaacctc
tctgtagctgatggtgtcgtcaacctgagcatccccattgtgctgccaatctcagcgcag
gacaagcagcggctggagggctgtggggcactggcactcagctacgcggggcgcagggtg
gccatcctcagggaccctgagtactttgagcacaggaaggaggagcgctgtgcccgcatc
tggggcaccacctgtgccaagcacccacacgtcaagatggtgatggagagtggagactgg
ctggtggggggagacctcgttgtgctggaaaagatctgttggaatgatggcctggaccag
tatcgcctgacaccgctcgaactcaagcagaagttcacagaaatgaacgccgatgctgtc
tttgcattccagctgcgcaaccccgtgcacaacgggcatgctctgctcatgcaggacaca
cggcgccagctcttgcagaggggttacaaaaaccccgtgcttctcctgcaccccctgggc
gggtggaccaaggatgacgacgttccgctggagtggcggatgaagcagcatgcggcggtg
cttgaggagcacgtcctggaccccaaatccactgttgttgccatcttcccttctcccatg
ctctatgccggccccacagaggtgcagtggcactgccgggctcgcatgatcgctggcgcc
aatttctacatcgtggggcgcgatcccgcgggcatgcctcaccccgagaccaagaaggac
ctgtatgagcccacgcagggagggaaggtgctcagcatggcgccaggcctgacctcggtg
gagatcatcccgttccgtgtagcggcttacaacaaagtgaagcgagctatggatttttat
gatccgaaaagacacgatgattttgacttcatctcaggaacacgcatgaggaagctggct
cgcgaaggggaaaacccacctgatggcttcatggcccccaaagcttggaaagtgctaact
gagtactaccaatcgctggaaaaaaagaattaa

DBGET integrated database retrieval system