KEGG   Gallus gallus (chicken): 423682
Entry
423682            CDS       T01006                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1 isoform X1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
gga04540  Gap junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    423682 (PRKG1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    423682 (PRKG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    423682 (PRKG1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     423682 (PRKG1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  PKG family
   423682 (PRKG1)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr PKcGMP_CC Kinase-like APH Pkinase_C DUF641
Other DBs
NCBI-GeneID: 423682
NCBI-ProteinID: XP_003641507
CGNC: 2785
Ensembl: ENSGALG00000003805
Position
6
AA seq 742 aa
MVIVAISRIPASPSGTKAFPLFLRFFRAPLLLPPPLPAAPRPVPGDVGPAAVSGAGRAAP
VPPPCERRGPTMSELEGDFTKLLLLKEERIRELERRLGEKDEEIQELRRRLHKCHSVLPA
PSPHIGPRTTRAQGISAEPQTYRSFHDLRQAFHKFTKAERSKELIKEAILDNDFMKNLEL
SQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGEL
AILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEI
LSKLADVLEETHYESGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLGKGDW
FGEKALQWEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEA
AFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSE
KQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVV
EAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEI
ILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAAN
LIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNF
DSFPEDNDEPPPDDNSGWDIDF
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggtaattgttgctatttccaggatcccagcctcgccgagtggcacaaaagcttttccc
ctttttctccgcttttttcgggccccgcttcttctccctccgcctctccctgccgctccc
cgcccggtgccgggcgatgtggggccggcggccgtgagcggggcgggcagagccgccccc
gtgccccctccatgcgagcggcgcggccccaccatgagcgagctggaaggggacttcacc
aagctgctgctgctcaaagaagagcgcatcagggaactggagcggcgcctgggagagaag
gacgaagagattcaggagctccgccgccgtctgcacaaatgccactcggtgctgccggcc
cccagcccgcacatcgggccccgcaccacgagggcgcagggcatctcggccgagccgcag
acctaccgctccttccacgacctccgccaggccttccacaagttcaccaaggccgagagg
tccaaggagctaataaaggaagcaatccttgacaatgacttcatgaagaatctggagctg
tctcagatccaggagattgtggattgtatgtatcctgtggagtatggcaaagacagctgt
atcatcaaggagggagatgtgggttccctggtgtacgtcatggaagatgggaaggttgaa
gtgacaaaagaaggcgtgaagctgtgcaccatgggaccgggcaaggtgttcggggagttg
gccatcctctacaactgcactcgaacagcaactgtcaaaactctcgtaaatgtgaaactt
tgggctattgatcggcaatgttttcaaacaataatgatgaggacaggcctcatcaagcat
actgagtatatggaatttttaaaaagtgttcccacattccagagccttcctgaggagata
ctcagtaagcttgcagatgtccttgaagagacacactatgaaagtggggagtatattatc
cgacagggtgctcgaggggacaccttctttataatcagcaaaggaaaggtgaacgtcact
cgtgaagattcccccagtgaggatccagtctttctccgtactttaggaaaaggagattgg
tttggagaaaaagcactgcaatgggaggatgtcagaactgccaacgtcattgcggctgaa
gcagtaacttgtctggtcatagacagagactccttcaaacatctgattggcggcctagat
gatgtttccaataaagcctatgaagatgcagaagcaaaagcaaaatatgaagccgaagct
gccttcttcgccaacctgaaactgtctgatttcaacatcattgacacccttggagtcgga
ggtttcggacgagttgaactggtccagttgaaaagtgaagagacgaagacgtttgcgatg
aagatcctgaagaaacgtcacatagtggacacaaggcagcaggagcacatccgctcggag
aagcagatcatgcagagcgctcactcagacttcatcgtgaggctctacaggacgttcaag
gacagcaagtacctgtacatgctgatggaagcctgtctaggtggagagctctggacaatt
ctcagggacagaggttcatttgaggattcaacaaccaggttttacacggcgtgcgtagtt
gaagcttttgcctatttgcattccaaaggaatcatttatagggacctcaagccagaaaac
ctcattctggatcatcgaggttatgccaaactggttgattttggctttgcaaagaaaata
ggatttggaaagaaaacatggactttttgtggaactccagagtacgtagcccccgagatc
atcctgaacaaaggtcacgatatttcagcagactactggtcactgggaatcctaatgtat
gaactcctgactggcagtccccctttctcaggcccagaccctatgaagacctataacata
atattaaggggaattgatatgattgaatttccaaagaagattgccaaaaatgctgctaat
ttaattaaaaaactatgcagggacaatccatcagaaagattagggaacttgaaaaatgga
gtgaaagacatccaaaagcacaaatggtttgaaggctttaactgggaagggttacgaaaa
gggacactgacacctcctataataccaagtgttgcatctccaacagacacaagcaatttc
gacagcttccctgaggacaatgatgaaccaccccctgatgacaactcaggatgggacata
gatttttaa

DBGET integrated database retrieval system