KEGG   Gallus gallus (chicken): 423735
Entry
423735            CDS       T01006                                 

Gene name
ADK
Definition
(RefSeq) adenosine kinase
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    423735 (ADK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     423735 (ADK)
SSDB
Motif
Pfam: PfkB Phos_pyr_kin Raf1_N
Other DBs
NCBI-GeneID: 423735
NCBI-ProteinID: NP_001006501
CGNC: 3760
Ensembl: ENSGALG00000005057
UniProt: Q5ZMK9
Position
6
AA seq 359 aa
MAAGEPQAKKLKLEPKQLSENVLFGMGNPLLDICAVVDKDFLDKYGLKPNDQILAEEKHK
ELFEELVKKFKVEYHAGGSTQNSVKVAQWMIQNPYKAATFFGCIGKDKFGEILKKKAEEA
HVDAHYYEQSEEPTGTCAACITSDNRSLVANLAAANCYKKEKHLDLEKNWKLVEKAKVYY
IAGFFLTVSPEAVLKVATQASANNKIFSLNLSAPFISQFYKEPMMKVMPYVDVLFGNETE
AATFAREQGFETEDIKEIARKTQALPKVNTKRQRIVIFTQGKEDTVMATENEVTTFPVLV
SDQSEIVDTNGAGDAFVGGFLSQLVYDRPVTECIRAGHYAASVIIKRSGCTFPEKPDFH
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcagcgggggagccgcaagccaagaagctgaagctggagccgaagcagctgagtgaa
aatgtcctgtttggaatgggaaatcctctgcttgatatatgtgcagttgtggacaaggac
ttccttgacaagtatgggctgaaaccaaatgaccaaattctggcggaggagaagcacaaa
gaactatttgaagaacttgtgaaaaagttcaaagtagaatatcacgctggtggctctact
caaaactctgtcaaagtggcccagtggatgattcagaatccatacaaagctgcaactttc
tttgggtgcattggcaaggataaatttggagaaatattaaagaagaaggctgaggaagct
catgtggatgcccattactacgagcagagtgaagaaccaacaggaacctgcgctgcctgc
atcactagtgataacaggtcacttgtagctaaccttgctgctgctaattgctacaagaag
gaaaagcatcttgatttggagaagaactggaagttggtggaaaaagccaaagtctattac
atagcaggattcttcctgacggtgtcaccggaagcagtattaaaagtggctactcaggct
tctgcaaacaacaagatcttcagcttgaatctttctgcaccgtttattagtcagttctac
aaagagcctatgatgaaagtcatgccttatgtggatgtcctttttggaaatgagacggaa
gctgccacttttgctagagagcaaggctttgagactgaagacattaaagagatagcccgt
aagacacaagccctgccaaaggtgaacactaaaaggcaacgaattgttatctttacccag
gggaaagaagacactgtaatggctacagaaaatgaagtaactactttccctgtgttggtg
agtgatcagagtgaaatcgtggataccaatggggctggagatgcatttgttggaggcttc
ctctcgcagcttgtctatgaccggccggtgaccgagtgcatccgagctggacactatgca
gccagcgtcattatcaagcgctcaggttgcaccttcccagaaaagcctgacttccactga

DBGET integrated database retrieval system