KEGG   Gallus gallus (chicken): 423738Help
Entry
423738            CDS       T01006                                 

Gene name
NDST2
Definition
(RefSeq) bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
  KO
K02577  heparan sulfate N-deacetylase/N-sulfotransferase NDST2 [EC:3.1.1.- 2.8.2.-]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
gga01100  Metabolic pathways
Module
gga_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    423738 (NDST2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    423738 (NDST2)
Enzymes [BR:gga01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     423738 (NDST2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     423738 (NDST2)
Glycosyltransferases [BR:gga01003]
 Unclassified
  Sulfotransferases
   423738 (NDST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSNSD Sulfotransfer_1 Sulfotransfer_3
Motif
Other DBs
NCBI-GeneID: 423738
NCBI-ProteinID: XP_004942132
CGNC: 3802
Ensembl: ENSGALG00000005107
UniProt: E1BYQ4
Position
6
AA seq 879 aa AA seqDB search
MIQLWKVVRHVRQLELHRLILLLIAFSLISMCILAYYVTNSPKIKEPPPLPFSDCSNQHR
ISIPPQASWRLTKSVDTSRTDPVVLVFVESIYSQLGQEIVAILESSRFKYRTEIAPGKGD
MPTLTDKDRGRYALIIYENILKYVNLDAWNRELLDKYCVEYGVGIIGFFKANENSLLSAQ
LKGFPLFLHSNLGLRDYHINPSAPLLYVTRANEVEQGPLPGDDWTVFQSNHSTYEPVLLA
STKSSESIPHLATHKALHATVVQDLGLHDGIQRVLFGNNLNFWLHKLIFVDGIAYLTGKR
LCLTLDRYILVDIDDIFVGKEGTRMKVSDVEALLSTQNKLRTLVPNFTFNLGFSGKFYHT
GTDEEDEGDDMLLKHRKEFWWFPHMWSHMQPHLFHNVTVLAEQMKLNKQFAVEHGIPTDL
GYAVAPHHSGVYPVHTQLYEAWKSVWSIQVTSTEEYPHLRPARYRRGFIHNGIMVLPRQT
CGLFTHTIFYNEYPGGSKELDKSIRGGELFLTVLLNPISIFMTHLSNYGNDRLGLYTFES
LVKFVQCWTNLRLQTLPPVQLAKKYFEIFPQEKNPLWQNPCDDKRHKDIWSKEKTCDRLP
KFLIVGPQKTGTTAVHFFLTMHPAVTSNFPSPSTFEEIQFFNGPNYHKGIDWYMEFFPIP
SNASTDFMFEKSANYFDTEVVPKRGAALLPRAKIITVLINPADRAYSWYQHQRAHNDPVA
LNYTFYQVISAKSQAPQELRNLQSRCLLPGWYSTHLERWLTYFPSGQILIVDGQELRHNP
ASVMDNIQKFLGVTPLFNYTQALRFDEAKGFWCQLLDGGKTKCLGKSKGRKYPDMDSSSR
LFLRDFYREHNIELSKLMNRLGQPLPTWLREELQNSSWS
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgattcagttgtggaaagtagtgcggcatgtgcgacagctagagctccacaggttgatc
ctgctgctcattgccttcagcctgatctccatgtgcatcctggcttactacgtcacgaac
agtcccaaaatcaaggagccaccacccctgcccttcagtgactgcagcaaccagcaccgc
atctcgatcccaccgcaagccagctggaggcttaccaaatctgtggacacctcacgcaca
gatcctgtggtgctagtctttgtagaaagcatctactcccagctggggcaggaaatagtg
gctatcctggaatctagccggtttaaatacaggacagagatcgcccctggcaaaggggat
atgccaacgttgacagacaaagataggggacgctatgctcttatcatttatgagaatatc
ctcaaatatgtgaatctagatgcttggaaccgagagctgctggacaaatactgtgtagag
tacggagtggggattataggctttttcaaagccaacgagaacagcttactcagtgcacag
ctcaagggtttcccccttttcctacattccaacttggggctgcgggactatcacatcaac
cccagtgctcctctgctctacgttacacgggctaatgaggtggagcaaggtcccctgcct
ggtgatgactggaccgtattccagtcaaaccacagcacctacgaaccggtgctgttggcc
agcacgaagtcctcagagtccattcctcacctggccacccacaaagcattgcatgccacg
gtggtgcaggatctgggtctgcatgacgggatccagcgggttctctttggcaataacctc
aatttctggctgcacaaactgattttcgtggatggcattgcctacttgactggcaagcgc
ctgtgtctcacgcttgatcgctatatcctcgtcgacatagatgatatatttgtgggaaaa
gagggcactcgcatgaaagtgtctgatgtagaggctttactgagcacccagaataagctg
agaactttagtcccaaatttcaccttcaacctgggcttctcagggaaattctaccacaca
ggtacagatgaggaagatgaaggcgatgacatgctactcaagcataggaaggagttctgg
tggttccctcatatgtggagtcacatgcagcctcatcttttccacaatgtcactgtgctg
gctgagcagatgaagctcaacaaacagtttgctgtggagcacgggatccccacagacttg
ggctatgctgtagccccccatcattctggggtttatcctgtccacacacaactctatgag
gcatggaaatctgtttggagcatccaagtaacaagcacagaggaatacccacacctgcga
cctgcccggtaccgacgtggattcatccataatggaatcatggttctgcctcgacagacc
tgtggcctttttactcacactatcttctataatgaatatcctggcggctcaaaggagttg
gacaagagcattcgtggcggtgaactcttcctgacagtgctcctgaacccaatcagcatc
ttcatgacccacctgtctaactatgggaatgaccgcctgggactgtacacttttgagagc
ctggtcaagtttgtgcagtgctggaccaaccttcgcctgcagacactgcccccagtccag
cttgcaaagaagtactttgaaatctttccccaggagaagaatcccttgtggcagaatccc
tgtgatgataagaggcacaaggatatctggtccaaagagaaaacatgtgatcgtctcccc
aagttcctcattgtgggacctcagaaaaccggcacaacagctgtgcatttcttcttgacc
atgcatccagctgtcaccagtaacttcccaagtccatccacttttgaggagatccagttt
tttaatgggcccaactatcataaaggaattgactggtacatggaattctttccaatcccc
tccaatgccagcacagacttcatgtttgagaagagtgccaattactttgacacagaggta
gtaccaaaacgtggtgcagccctgcttcctcgagccaaaatcattactgttctgatcaac
cctgcagacagagcctactcatggtatcagcaccagcgagctcacaatgaccccgtggca
ctcaattacaccttttaccaagtgatctctgcaaaatcccaggcccctcaggagctgcgc
aacctgcaaagccgatgcctgcttcctggctggtattcaactcatctagagcgctggcta
acgtacttcccctctgggcagattctcattgtggatggtcaggagctgagacacaaccct
gcctctgtaatggacaacatccagaagttcttgggagttacaccactcttcaactacact
caggccctaagatttgatgaagcaaaaggattttggtgccagctgttagatggaggaaag
accaaatgcctgggaaagagtaaaggaagaaaataccctgacatggattcctcgtcacgg
ctgttcctaagagacttctaccgggagcacaacattgaattatccaagctgatgaacaga
cttggacagccccttccaacctggctccgagaggaactgcagaactccagctggagctga

DBGET integrated database retrieval system