KEGG   Gallus gallus (chicken): 423779
Entry
423779            CDS       T01006                                 

Gene name
ARHGAP22
Definition
(RefSeq) rho GTPase-activating protein 22 isoform X2
  KO
K20642  Rho GTPase-activating protein 22/24/25
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    423779 (ARHGAP22)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    423779 (ARHGAP22)
SSDB
Motif
Pfam: RhoGAP PH PH_11 PH_8 FPP ATG16 PH_3 Tropomyosin_1 PspA_IM30 CENP-H DUF4337 HAUS-augmin3
Other DBs
NCBI-GeneID: 423779
NCBI-ProteinID: XP_004942183
CGNC: 4605
Position
6
AA seq 750 aa
MEEPPLEEKPSCEEEACCSLSLKEQSFGTGEVVSGAVLQRARSKSLVMGEQIGPPSRPSS
PNPQERVVKCGWLKKQRSIMKNWQQRWFVLRGDQLFYYKDEEETKPQGLILLQGNQVNEL
PPNPDEPGKHLFEIAPGGAGDREKMPVNHEAFLLMANSQNEMEDWVKAIRRVIWAPFGGG
IANSSHAHKLKHLPQGIFGQRLEDTVQYERKYGQRLAPLLVEQCVDFIRERGLTEEGLFR
MPGQANLVKDLQDSFDCGEKPLFDSNTDVHTVASLLKLYLRELPEPVIPFAKYEDFLSCG
QLLSKDEGEGTQELVKQVKNLPQANYNLLKYICKFLDEVQAHSSVNKMSVQNLATVFGPN
ILRPKMEDPVTMMEGTSLVQHLMTVLISEQGRIFAVPQADVPGSQLEIRPVRPRNTVEWI
SEEDGEDSRSESNVPSPADLPSGNAVSLEATPGPVLKNTPPEHSSKLAQPATSPSKRVQT
LPPWKYSFRQQGARSGSPKLGSSSLDIPNLSSSGNWLMNGLYSLRGHRRTASGERVKDSC
SSQRLSTYDNVPSSSLSLSTHSMGSTTWSTSSCEISVVDSVSSCPACRASDSSALSSLQT
EWMTQGSLSQSEVKTADLENSIDRLEACSSSSEQSNLAPASRDSVRCSRALQSLVVELKT
ELSKQRTEYETSIKRIEEASADLRKQVVRLEEELDQERKKYTMLEIKLRNSERAREDAEK
RNHLLQKEMEEFFSTLGCLTGGSQSAKVPK
NT seq 2253 nt   +upstreamnt  +downstreamnt
atggaagagccgccattagaggagaagcccagctgcgaggaggaggcctgctgcagcctt
tctttaaaagagcaatcttttgggacaggagaggtagtttcaggagctgtactccagaga
gcccgatcaaagagtttggtgatgggtgagcagattgggcctccctccagaccttcttct
cctaaccctcaagaacgtgtggtgaagtgcggctggctgaagaaacagaggagcattatg
aagaactggcagcagcgttggtttgtgctgcgtggagaccaactcttctattataaggat
gaagaggaaactaaacctcagggtctcattctgctgcaaggcaatcaagtgaatgagctg
ccacctaatcctgatgagcctggaaaacatctatttgaaattgccccaggtggtgctgga
gaccgggaaaagatgcctgtcaatcatgaagctttcctgcttatggctaattcccagaat
gaaatggaagattgggtgaaagccatccgacgggttatatgggctccttttggtggaggt
attgcaaatagctcacatgcacataaattaaaacatttgcctcaagggatctttggacag
cgattggaggacactgtgcagtacgagaggaagtatggccagcggttagccccactgctg
gtggaacagtgtgtggattttattcgggagcgaggtcttacagaggagggactctttcgg
atgcctggtcaagccaaccttgtcaaagatttgcaggattcttttgactgtggagagaag
ccgctctttgacagcaacacggatgttcacactgtggcgtccctcctgaagctttacctc
cgagagctgccagagcctgtcatcccctttgccaaatacgaagactttctttcttgtgga
cagctactctcaaaagatgagggagagggtactcaggaactggttaaacaggtgaagaat
ttgccccaagccaactacaacctcctgaagtacatatgcaagttccttgatgaagttcaa
gctcactccagcgttaacaagatgagtgttcagaacctagctacagtatttggaccaaat
atattacgacccaaaatggaagatccagtgaccatgatggaaggcacctcactggttcag
cacctgatgacggtgctgataagtgaacaggggagaatctttgctgtccctcaggcagat
gtgccagggagccaactggaaattagacccgtgcgtccacgcaacaccgtggagtggatc
tctgaggaggatggagaggacagcaggtcagaaagcaatgttcccagccctgctgatctg
ccttctggcaatgctgtgtcactggaggccacccctggacctgtattgaaaaacacccct
ccggagcacagcagcaagttggctcagcctgccaccagtcccagcaaaagagtgcagacg
ctgcctccatggaaatactcgttccgccaacagggagcacggtctgggagcccaaagttg
ggcagctcatccctagacatccccaatctctcctcgagtggaaactggctaatgaatgga
ctgtactctctccgaggccaccgccggacagcctctggggaacgagttaaagactcttgt
tcttctcaaagactttctacttatgacaatgtcccttcgtccagcctctccctcagcaca
cacagtatgggcagcaccacttggtctacatcatcgtgtgagatctccgtggtggactca
gtcagcagctgcccagcctgtcgggccagtgactcctcggctttaagctctctccaaact
gagtggatgactcagggctcactgtctcagagtgaggtcaagactgcagatctggagaac
agcatcgacaggttagaagcctgcagcagcagcagtgagcagagcaacctagctccagct
tccagagactctgtcagatgctctagggccttacagagcttggtggtagagctaaagaca
gaactgagcaaacagaggactgagtacgagaccagtatcaaaagaattgaagaagcaagt
gcagacctgaggaagcaagtggttaggctagaagaagaactggaccaagaacgaaagaaa
tacacaatgctggagataaaactgaggaattctgaacgtgctcgggaagatgcagagaag
aggaatcacctcctgcagaaggaaatggaagagtttttttcaacattaggatgtttaact
ggtgggagtcaaagtgctaaagtccccaaatag

DBGET integrated database retrieval system