KEGG   Gallus gallus (chicken): 423787
Entry
423787            CDS       T01006                                 

Gene name
ACTA2
Definition
(RefSeq) actin, aortic smooth muscle
  KO
K12313  actin, aortic smooth muscle
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    423787 (ACTA2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    423787 (ACTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    423787 (ACTA2)
   04147 Exosome [BR:gga04147]
    423787 (ACTA2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     423787 (ACTA2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   423787 (ACTA2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 423787
NCBI-ProteinID: NP_001026400
CGNC: 52051
Ensembl: ENSGALG00000006343
UniProt: P08023
Position
6
AA seq 377 aa
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILSERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgaggaggaggacagcactgcccttgtttgtgacaatggctcagggctctgtaaa
gctggctttgccggggatgatgctccaagagcagttttcccttccatcgtgggtcgtccc
aggcaccagggtgtgatggttggtatgggtcaaaaagacagctatgtaggtgatgaggct
caaagcaagagaggaatcctgaccttgaaataccccatagaacatggcatcattaccaac
tgggatgacatggagaagatctggcatcactccttctataatgagctccgtgttgcacct
gaggagcacccaactctgctgactgaagcaccactgaatcccaaagccaatcgagagaaa
atgacccagattatgtttgagactttcaatgtgccagccatgtatgtagctattcaagct
gttctgtccctgtatgcttctgggcgtactacagggattgtgcttgactctggggatggt
gtcacccacaacgtgcccatttatgaaggctacgctttgccacatgccatcatgcgtctg
gacctggctggccgtgacctgacagactacctcatgaagatcctgagcgaacgtggctac
tcctttgtgaccactgcggagcgtgaaattgtccgtgacatcaaggagaaactgtgttat
gtggccctggactttgaaaacgagatggccactgctgcctcttcctcctctctggaaaaa
agctatgagcttcctgatggccaggtcatcaccattggaaatgaacggttccgctgccca
gagactctcttccagccatctttcattggcatggagtccgctggcattcatgaaaccact
tacaacagcatcatgaagtgtgacatagacatcagaaaggatctttatgccaacaatgtg
ctttctggaggcactacaatgtacccaggcattgcagacagaatgcaaaaggaaataact
gctctagctcccagcaccatgaagatcaagatcattgctcctcctgaacgtaagtactcc
gtctggattggaggctctattcttgcctccctctccaccttccagcagatgtggatcagc
aaacaggaatatgatgaggctggcccatccatcgttcaccgcaaatgcttttaa

DBGET integrated database retrieval system