KEGG   Gallus gallus (chicken): 423825
Entry
423825            CDS       T01006                                 

Symbol
ADGRA1L
Name
(RefSeq) adhesion G protein-coupled receptor A3
  KO
K08460  adhesion G protein-coupled receptor A1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    423825 (ADGRA1L)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    423825 (ADGRA1L)
Peptidases and inhibitors [BR:gga01002]
 Mixed peptidases
  Family P2
   423825 (ADGRA1L)
G protein-coupled receptors [BR:gga04030]
 Adhesion receptor family
  Others
   423825 (ADGRA1L)
SSDB
Motif
Pfam: 7tm_2 GPS I-set HRM Ig_3 ig
Other DBs
NCBI-GeneID: 423825
NCBI-ProteinID: XP_025007664
CGNC: 5319
Ensembl: ENSGALG00000007045
Position
6:complement(22593616..22752247)
AA seq 1168 aa
MFVGLNSLHKLNLSGNIFSSLMNGLFSELLALKALHFNTDSLICDCNLKWVLQWARNASV
RIAEETVCAYPSALQGLSFRNLKENQLICAGPLELPLFELIPSQRQVVFHGDRLPFQCTA
TYVDKTTQVHWYHAGRLIETDEESGIFVEDSIIHDCCLITRELILSSIDINASGDWECLV
NNSYGNSTKHVEIVVLEMAAPYCPAERVINNKGDFRWPKTLAGITAYHPCLQYSFNSIAF
HNGVEESKAWRKCNRTGRWDEENYSECPYSQEITQVLHAFSQMHINLTTVLEFSRQLTAY
TRGASHFADKMDVIYLAYIMEKLIVFVDEVEDIGDALIEIASNIMSVDDHVLWMAQKEDK
ACTRIVRCVEHIASQILTSNIQVISKVSHNIALEAFMIKPSNFMGMTCTAFQKIPANVDK
PVVHDLGSWEADPRSDQHLNFKCNTGNLNGSLLNSSTRNAVAVASVHLPQSVFSRSSAWQ
SVDNATCKLQFIVFRNGKLFPSTGNSSNLADDGKRRTVATPAVFAKIDGCSFGNLTSPLT
IGLRHFARGIDPIAAFWDFDLLDGHGGWWGEGCHIISSAGNITTIQSTHFSNFAVLMDFK
TVLSFPQYPGEFLHPVVYACTAVMLLCLFASIITYIVHHSTIRISRKGWHMLLNFCFHTA
LTFAVFAGGINRIKYPIICQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKTQSCQNGDQ
PSYPKQPLLRFYLISGGVPFIICGITAATNINNYGIEGNAPYCWMAWEPSLGAFYGPIAF
IVLVTCIYFLCTYIQLKRHPERKYELKERTEDPQRMPSTEVGHSHITDAASIPQAACSMI
SSSLLENEHSFKAQLRAAAFTLFLFTATWTFGALAVSQGHFLDMIFSCLYGAFCVTLGLF
ILIHHCAKRDDVWHCWWSCCPSRRNTYSVQVNVRPKVNVNGDTQVHAPCLQESPCPNKSA
VFNHPAASHCKLTNLQAAQNHVNCLSPVTPCCAKMHCDQLLDDEAHIHVHNEGSFRPNMH
IHRCLKSRTKPRYFSRHRSAGEREYAYHIPSSIDGSIHSSHTDSPHSTHDSQSGHRRACC
SKSDPYPTVNQPESSDASTVIYSCTKMPESDTVHHPAHFEMHPRTQSLPFNTTNHNGILK
GNVHEAMIYSSDSTGNIKTGPWKNETTV
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgttcgttggacttaatagtcttcacaaactaaatttgtcagggaatattttttcaagt
ctcatgaatggactgttctctgagctgctagctctgaaagcgctgcatttcaacaccgat
tcgctcatttgtgactgtaatctgaaatgggtcttacaatgggctagaaatgcttcagtc
cgaattgcagaggaaacagtgtgtgcttaccccagtgctttacaaggactgtcatttcgt
aacctgaaggaaaaccaactgatatgtgctggacctctggagcttcctctttttgagctg
atcccctcacaaagacaagtggtttttcatggagaccgcttgccctttcagtgtactgca
acctacgttgacaaaactacccaagtacattggtaccatgctggtcgacttattgaaaca
gatgaagagagtggcatatttgtggaggacagcatcattcatgactgttgtttaattaca
cgtgaacttatcctgtctagcattgatattaatgcatctggagattgggagtgtctagtc
aacaattcctatggaaatagcactaaacatgtagaaattgtggtactggaaatggcagca
ccctactgccctgcagaaagagttattaacaacaagggagatttcagatggcccaaaact
ttggctggaataactgcttaccatccttgtcttcagtattcatttaactccattgccttt
cacaatggtgtagaagagtctaaggcatggcgtaaatgtaatcgaactggacgctgggat
gaagaaaactattctgaatgtccttattcacaagaaataactcaagttcttcatgctttc
agtcagatgcacatcaatttgacgactgtacttgaattttcccgccagctgacagcctac
acaagaggtgcttcccactttgcggataaaatggatgtaatatatttggcttacataatg
gaaaagttaattgtcttcgtggatgaagttgaagatataggggatgctctcattgaaatt
gccagcaatataatgtctgttgatgaccatgtgttgtggatggctcaaaaggaagacaaa
gcctgcaccagaattgtgcggtgtgtggaacatattgcaagtcaaatactgaccagcaac
attcaagttatttcgaaggtatctcataatattgctctggaggcctttatgatcaagcct
tctaatttcatgggaatgacttgcactgccttccaaaaaatacctgcaaatgttgacaag
ccagttgtgcatgatttgggaagctgggaagcagatccccgttctgatcaacatttgaat
ttcaagtgcaacactggcaatctgaatggttccttgttgaattcttctaccaggaatgct
gtagcagtagcttcagttcatttgccacagtctgtcttctctcggtcttcagcctggcaa
tctgttgataacgcaacttgcaagctacagtttattgtctttcggaatggaaaactcttt
cccagcacaggaaactcatcaaatcttgcagatgatgggaaacgtaggacggttgccaca
ccagctgtttttgctaaaatagatgggtgcagttttggaaacctcaccagccctcttact
atagggttgaggcactttgcacggggtatagaccccattgcagccttctgggattttgac
cttctagatggacatggaggctggtggggagaagggtgccacataattagttctgcaggc
aatattaccaccattcagagtacacacttcagtaactttgcagtgctaatggattttaag
acagtgctgtcttttccccagtacccaggggagtttctgcaccctgtggtatatgcatgt
actgcagttatgttgttgtgcctgtttgcttccattatcacctacattgtccatcacagt
acaatccgaataagtagaaaaggatggcacatgcttctcaacttttgtttccatactgct
cttacctttgctgtttttgctggtggaatcaatcgcattaaatacccaattatatgtcaa
gctgttggcatagtacttcattattctacactatctactatgctatggattggagtaaca
gcaaggaatatttacaagcaagtcacaaaaaaaactcagtcatgccaaaacggtgaccaa
ccttcttatccaaaacaaccactgctcagattttatctgattagtggtggagttcctttc
attatatgtgggattacagcagcaaccaatatcaataattatgggattgaaggcaatgca
ccatattgctggatggcatgggagcctagtcttggtgctttttatgggccaatagcattc
attgtgctagttacctgtatttattttctctgcacgtacattcaactgaagcgccatcct
gaacgcaagtacgagttaaaggaaaggacagaagatccgcagagaatgccaagtactgag
gtgggccacagtcacattacagatgctgcatccattccccaggcagcctgctccatgatt
tcttcttccttactggaaaatgagcattcatttaaggctcagcttcgagctgcagcattc
actttgttcctgtttactgccacttggacctttggagcgcttgcagtatctcaaggtcat
ttcttggatatgatttttagctgtctttatggagccttctgtgtgacgctggggcttttc
atcctgatccatcactgtgcaaagcgagatgatgtgtggcattgctggtggtcctgttgt
ccatctaggagaaacacctattctgtccaagttaatgtgcgcccaaaggtcaacgtcaat
ggggacactcaagttcatgcaccgtgtcttcaggaatcaccatgtcccaacaaatcagct
gtgtttaatcatccagctgctagccactgcaaactcactaacctccaagcggctcaaaat
cacgttaactgcctttctcctgtgacaccatgttgtgcaaaaatgcactgtgaccagcta
cttgatgatgaagctcatattcatgtccacaacgagggaagcttcagacccaatatgcac
attcatagatgtctgaaaagcagaactaagccacgttatttcagtcggcatagatctgca
ggtgaaagagaatacgcctaccatattccttcaagtattgatggcagcatccacagttca
catacggacagcccccacagtacacatgatagccagtcgggtcacagacgggcctgctgc
tcaaaaagcgatccatatcctactgtcaaccagcccgaaagtagcgacgcaagtactgtc
atatatagttgtactaaaatgccagaaagtgacactgtgcaccatccagctcattttgaa
atgcatccacggacacaatcattgccgtttaatacaacaaatcataacggaattctcaag
ggaaacgtgcacgaagccatgatatacagctcagatagtacaggaaatatcaaaactggc
ccttggaaaaatgaaactactgtgtag

DBGET integrated database retrieval system