KEGG   Gallus gallus (chicken): 423871Help
Entry
423871            CDS       T01006                                 

Gene name
NT5C2
Definition
(RefSeq) cytosolic purine 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga00240  Pyrimidine metabolism
gga00760  Nicotinate and nicotinamide metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    423871 (NT5C2)
   00240 Pyrimidine metabolism
    423871 (NT5C2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    423871 (NT5C2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     423871 (NT5C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 423871
NCBI-ProteinID: NP_001026405
CGNC: 6204
Ensembl: ENSGALG00000008179
UniProt: Q5ZIZ4
Position
6
AA seq 569 aa AA seqDB search
MTTSWSDRLQNAADLPANMDGHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY
KSPEYESLGFDLTVERLVSIGYPHELLNFVYDPAFPTRGLVFDTHYGNLLKVDAYGNLLV
CAHGFNFLRGPETRDQYPNKFIQRDDTDRFYILNTLFNLPETYLLACLVDFFTNCDRYTS
CETGFKDGDLFMSFRSMFQDVRDAVDWVHYKGSLKEKTLENLEKYVVKDGKLPLLLSRMN
EVGKVFLVTNSDYKYTDKIMTYLFDFPHGPKPGSAHRPWQSYFDLILVDARKPLFFGEGT
VLRQVDTVTGKLKIGTYTGPLQHGIVYSGGSSDTVCDLLGAKGKDILYIGDHIFGDILKS
KKRQGWRTFLVIPELAQELHVWTDKSALFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAA
HVLMPHESTVEHTHVDINEKESPMATRNRTSVDFKDSDYKRHQLTRSISEIKPPNLFPQA
PQEITHCHDEDDDEEEEEEEVEEEEEEEE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctcatggagtgaccgactccagaatgcagcagatctccctgcaaacatggat
gggcatgctctgaaaaagtaccgccgggaagcctatcaccgggtctttgtaaacagaagt
ttagctatggaaaagatcaagtgctttggttttgatatggattatacgcttgctgtgtat
aaatcccctgaatacgaatctcttggatttgacctgaccgtagaaagattagtttccatt
ggatacccacatgagctgctcaattttgtgtatgatcctgcattccctaccagaggcctg
gtgtttgatacccactatggaaacctgctgaaagttgatgcctatggaaacctcctggtg
tgtgcacatggctttaacttcctcagagggcctgaaacacgggatcaatatccgaacaaa
tttatccagagagatgacacagataggttttacattctgaacacattgttcaatctacca
gagacctacctattggcttgccttgtggatttctttactaattgtgaccggtacactagc
tgtgaaacagggtttaaagatggagacctcttcatgtcattcaggagtatgttccaagat
gtcagagatgctgttgactgggttcattacaagggatcgctcaaggagaagacccttgaa
aatttggaaaagtatgtggtgaaagatgggaagctgccactgctgctgagccgcatgaac
gaagttgggaaggtgtttcttgtgacaaacagtgactacaaatacacagataaaattatg
acttacttgtttgactttccacacggaccaaagcctgggagtgcccatcggccatggcag
tcctactttgaccttatcctggtggatgcacggaaacccctcttctttggggaaggcact
gtgctgcggcaggtggacacggtgactgggaagctgaagattggtacctacactggccca
ctgcagcacggcattgtgtattcaggaggctcctcagacacagtctgtgacctgctgggg
gctaaaggaaaggatattctgtacattggagaccacatctttggagacatcctcaaatcc
aagaagcgccagggctggaggaccttcctggtgatccctgagttggcacaggagctacat
gtctggactgacaaaagcgccctttttgaagagttgcagagcctggacatcttcttggcc
gagttatacaagcatctggacagtagcagcaatgaacgccctgacatcagctccatccag
agacgcattaagaaagtgacccatgacatggacatgtgctacgggatgatggggagcctc
ttccgcagtggctcccggcagacactgtttgccagccaggtgatgcgctacgctgacctc
tatgcagcctccttcatcaacctcctttactaccccttcagctacctcttcagagccgcc
cacgtcctgatgccacacgagtccacggtagagcacacacacgttgacatcaacgagaag
gagtcacccatggccacgcgcaatcgcacctcggtggattttaaggattctgactacaag
cggcaccaactgacccgctccatcagtgagatcaaaccgcccaacctcttcccccaggca
cctcaggaaatcacacactgccacgacgaagatgacgatgaggaagaggaagaggaggag
gtagaggaggaggaggaggaagaagaataa

DBGET integrated database retrieval system