KEGG   Gallus gallus (chicken): 423874Help
Entry
423874            CDS       T01006                                 

Gene name
PDCD11
Definition
(RefSeq) protein RRP5 homolog isoform X2
  KO
K14792  rRNA biogenesis protein RRP5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gga03009]
    423874 (PDCD11)
Ribosome biogenesis [BR:gga03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    423874 (PDCD11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S1 Suf TPR_19 TPR_14 TPR_15 TPR_16 TPR_12
Motif
Other DBs
NCBI-GeneID: 423874
NCBI-ProteinID: XP_004942318
CGNC: 6260
Ensembl: ENSGALG00000008265
Position
6
AA seq 1837 aa AA seqDB search
MASMEENFPRGGIQKKPTGTTGKKAKPKFEQDNLFDVHHEEQTQKRKRSEGDHRKQKKFK
ADIKAPAKDIAISIEPLTIKELCEGMLFLGCIKEVTVFELVISLPNGLTGFVPVTHISDA
YSELLSKQVTQGELLEDLNSLSDLYSPGMLVRCVVTSVEKSADGRRSIKLSINPKSVNKG
LSASALTSGMLLSGFVSSVEDHGYLIDIGVSGTHAFLPHQKAQNYIKAVKRGSDLKIGQS
LNCVIEEVKNEGRVVRLSADRSEVAASIATEQQNWTLSNLLPGLVVKAQVQKVAPLGVSL
TFLSSFTGIVDFMHVDPEKSTNYSPNQMVKACILSTHPTSKVVRLTLRQAFLHPGGSPNQ
LSNDRIGAVVEESTVKAFYKQFGAVFQLDDGMLAFARPKHLSKTRKSFKPAAFKAGCKHK
CRIIDYSLMDEMCIVSLKHQIIEARFLRYEDIHTGDVMQGKVLSLKPIGMQVKVTDGIKG
LVPSMHLADVILKQPEKKYNVGDEVRCRVLECNPAEKKLFLTLKKTLVQSKLPVLSSYED
AEPGLITHGFVVCAREFGCIVKFYNDVKGLVPKNELSSEPISCPDKVFHDGQVVKVMVLK
CEPQQERLLLSFRLSSRTVPEGRSECIPKKKQQVKYQIGEMVDVEVLKKNENGLEVSILE
DGGNVIAWLPTVHLSDFVANSKLLWHCLQEGDVLPRVMCLSDKGDRIILCRKSAVISAVQ
EEQVVRSFSEIQPGVLLIGYVRKVMPFGVFVEFPFGVTGLAPKVSMSDKFVTDTKDHFVV
GQTVIAKVMSIDEEKQRVLLSLKVSECSSGDSAAESFSLLNQYFKEVEEIRNLLRRREES
GLARCVCELVPGKELQLVVQDVMEDGSALFSGGCVRGLTVTATRYHLGGKNVIPGEKAKG
LVLHVDAITSKVYVSLREELLKKRAKQRLTKNSQHPAIVQHIAEEFAIVSLLDSGRLAAI
PIASHFNDTFRFDSEKLKVGQRIYATLKMVKANDLGVLLAVQDPAKKNAFVRDRKESETA
LEETLAAAVKHSLSLGDIVTGTVKSVKPTHVTVAIDDKLTGSIHASRILDEVPIHSFPTY
TLKAGQKVTARVIGGRDVNTHRYLPITHPHFTRSVPELSIRPSEIEGEVETMRDDTREKL
GPYNTGQTVTCFVRKYNTLKNWLEVEVTPDVRGRVPRLLLSLNTKVLKHPEKNFKNGQAL
SATVTGTDATETNLFLSLTGIQSLEPGTITVGMVAKMIPHIGLTITLPGGKAGKVSIFHL
SDKYTESPLSDFKIGKVVRCYILSNENGKIQLSLRQSRLNPRNSRKVEDVEITCIKDVKK
GQLVRGYVKSVTPSGVFFGLSASLLGRILFQNVSPYFVQKHSLYEKYLPEGKLLTAKVLD
VNKKENHVELSLLPEDTEMPSVLPESLGLPRCGAEEEKREEDNKEKKEEVKMKRKQRRVN
SESEQETKPKKRKFSPADENDSGIEVYYREEEDGDQEEEAAKKKSKIRKCGEVPRLQVSA
GFTWDEDMNALEVPVLNQKEESSESEEEEENLQSKKKQTKKEKELEKQKKEKELCKLEAA
LMDPSRQPQSADDFDRLVLSSPNSSILWLQYMAFHLQATEIEKARAVAERALKTICFREE
QEKLNVWVALLNLENMYGTEETLMKVFERAVQYNEPLKVFQHLCDIYASSEKYKQAEELY
HTMLRRFRQEKSVWLKYASFLLKQGQTEATHRLLERALKALPTKEHVDVISRFAQLEFRF
GDPEHAKALFESTLNSYPKRTDIWSIYMDIMIKQGSQKEIRDIFERVIHLNLAPKKMKFF
FKRYLDYEKKYGTTETVMAVKTAALEYVEAKSSLADT
NT seq 5514 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatggaagaaaactttcctcgagggggtatccagaagaagcccacagggaca
acaggaaaaaaagcaaagccaaagtttgagcaggataacttgtttgatgttcaccatgaa
gaacaaacgcagaaaagaaaaaggagtgaaggggatcataggaagcagaaaaagttcaag
gcagacataaaagctcctgctaaagacattgctattagcattgaaccactcacaattaag
gagctctgtgaggggatgctgttccttggttgtataaaagaggtcactgtctttgagctg
gtcatcagcttgcccaatggacttacaggatttgtgcctgtcacgcacatcagtgatgcc
tatagcgaattgttgagcaagcaagtgacccaaggggagctgctggaggacttgaattct
ctctcagacctgtattctccagggatgctggtcagatgcgttgtgaccagtgttgagaaa
agtgctgatggacgtcggagtatcaaattgtccatcaaccctaaaagcgtcaacaaaggt
ctgagtgcatcagcactaacgtcaggcatgctgctctctggatttgtgtctagtgtagaa
gaccatggctacctcattgatatcggagttagtgggactcatgccttccttcctcatcag
aaagcccaaaattacatcaaagcagtcaagagggggtctgacttgaaaatagggcagagc
ctgaactgcgtcattgaggaagtgaagaatgaaggaagagtggtccgtttgtctgctgat
cgatcagaggttgccgcatccattgcaacagagcaacagaactggacactctctaatcta
ctgccagggctggtggtaaaagctcaagtgcagaaggtggctccactgggtgtcagtctg
acctttctatcttccttcactggcattgtggatttcatgcatgtggacccagagaaatcc
acaaattattccccaaatcaaatggtgaaggcttgcatcctctctacccaccccacctcc
aaggtggtgcggcttactctgcggcaggccttcctccaccctggaggttccccaaaccag
ctctccaacgatcgcataggggcagtagtagaagagtctacagtaaaggctttctacaag
cagtttggtgctgtttttcagcttgatgatggcatgcttgcattcgcacggccgaaacat
ctatcaaaaactagaaaatcttttaaacctgcagcgttcaaggctggatgtaagcataag
tgtcgaatcattgactacagcctgatggatgagatgtgcatagtatctctgaagcaccaa
attattgaagctcgtttcctgcgatacgaagatattcacacgggggatgtcatgcagggc
aaagtattgtctctgaaacccattgggatgcaggtgaaagttactgatggaattaaagga
cttgtgccatccatgcatcttgctgatgtgatcctgaaacagcctgagaagaagtacaac
gtaggagatgaagtcaggtgtcgggtattggagtgcaatcctgcagaaaagaagctattc
cttactttaaagaaaactcttgtgcaatcaaagcttccagtcctctccagttatgaagat
gcagaaccaggtctgatcacacatggctttgtggtgtgtgcaagggaatttggctgcatt
gtgaagttctacaacgatgtcaaaggtctggtacccaagaacgagctgagctcagagccc
atatcttgtccagataaagtcttccacgacggtcaggttgttaaagtaatggtcttaaaa
tgtgagccccagcaggaaaggctcttgctgtccttcaggttatcaagcaggactgttcct
gaaggcagaagtgagtgtattccaaagaagaaacagcaagtgaaatatcaaataggagag
atggttgatgtggaagtcttgaagaagaatgagaatgggctcgaggtttctatcttagaa
gacggaggcaatgtgatagcctggcttcctacagtgcacctctctgactttgttgctaac
tctaagctcctgtggcattgccttcaagagggagatgtcttgcccagagttatgtgcctg
agtgacaagggggaccgtattatcttgtgcaggaagtctgcagtgatttctgccgtgcag
gaagagcaagttgtgagaagtttctctgaaatccagcctggggtgctgctgattggctat
gtgagaaaggttatgccctttggagtgtttgtggaattcccttttggtgtgacaggactg
gcacctaaagtgagcatgagtgacaagtttgtgacagacaccaaagaccactttgtggtg
gggcagactgtaattgcaaaggtgatgagcatcgacgaggagaagcagcgtgtgctcctc
agtctgaaggtgtcggagtgcagctctggtgattcagctgcagagagcttttcactgctg
aatcagtatttcaaggaggtggaggaaatcaggaacctgttgagaagaagagaggagtct
ggcttagcccgatgcgtttgtgagctggtgcctgggaaggagctgcagctggttgtgcag
gatgtgatggaggatggctcagcactcttcagtggcggctgtgtcagaggcttgactgta
acagctactcgctaccacttgggaggcaaaaatgtcattcctggtgagaaagcaaaggga
ctggttcttcatgtggatgccatcacatccaaggtgtatgtttctcttcgagaagaactc
ttaaaaaaaagagccaagcaacggctcacaaagaactcccagcaccctgccatcgtgcag
cacatagcagaagagtttgccatcgtgtctctgttggactcaggccggctggcagctatc
cccatagcctctcacttcaatgataccttccgctttgactcagaaaaactgaaggtggga
caaagaatctatgcaaccttaaaaatggtgaaggcgaatgatcttggagtcctgttagca
gtgcaagacccagcaaagaagaatgcttttgtaagggaccggaaagagtctgagacagca
ttagaagagacacttgctgctgctgtgaaacactctctttctctgggtgatattgttact
ggcactgttaaatctgtcaaaccaacccatgtcacagttgctattgatgacaaattgacg
ggttcaatccatgcatcccggattctggatgaagtgcccatacactcttttccaacatac
actctgaaagctggacagaaggtgactgctcgggtcattggaggcagagatgtgaacact
cacaggtacctgcccatcacccatccacacttcacacggtccgttccagagctcagcatt
cgaccaagtgaaatagaaggggaagttgaaacaatgagagatgacacccgtgagaagctt
ggaccctacaacactggacagacagtcacctgttttgtgaggaagtataacaccctgaaa
aattggctggaggtagaagtcacccctgatgttcgaggaagagttcctcgtctgctgctg
tctctgaacaccaaggtcttaaaacatccagaaaagaacttcaaaaatggccaagcatta
tctgctacagtgactggaacagatgccactgaaacaaacctcttcttgtcgctcacagga
atacagtcactggaaccaggtaccatcactgtaggcatggtagcaaaaatgattcctcac
attggtttgaccatcactctgccaggtgggaaggctggcaaagtcagtatctttcaccta
agcgataagtacacagagagtcctctgagtgacttcaaaattggcaaggttgtcagatgt
tacatcctctccaacgagaacggcaaaatccaattatctcttcggcagtccagattaaac
ccaaggaacagcaggaaagtggaggatgttgaaataacatgtattaaggatgttaaaaaa
ggccagctagtaagaggctatgtcaaatcagttactccatcaggtgtattctttggcttg
tctgcttctcttctgggccgaatccttttccagaacgtttccccttactttgtacagaaa
cactccttatatgagaaatacctgccagagggaaagctgctcactgccaaggtccttgat
gtcaataaaaaagaaaatcacgttgagctctctctcctgcctgaggacactgagatgcca
agcgtcttgcctgaatccctaggcttaccacgctgtggtgcagaggaagagaaaagagaa
gaagataacaaggagaagaaagaagaagttaagatgaagagaaaacagaggagagtgaac
tctgagagtgagcaggaaacaaagccaaaaaaaaggaagttctccccagcagatgaaaat
gacagtggaattgaagtgtattaccgggaagaagaggatggtgaccaggaggaagaggca
gctaagaagaaatctaagataaggaaatgtggtgaagttcccaggctgcaagtttccgca
ggcttcacctgggatgaggacatgaatgcactggaagtgcctgtactgaatcagaaggaa
gagagctcagagagtgaggaggaggaggagaatctgcagtctaagaagaaacaaacaaag
aaggagaaggagctggagaagcagaagaaggagaaagagctatgcaaattagaggcagcc
ctgatggaccccagtcgtcagccccaatcagcagatgattttgaccgtctggtgctgagt
agtcccaacagctccatcctctggctgcagtatatggctttccacctccaggctactgag
attgagaaggctagagctgtggcagagagagcacttaaaacaatctgtttcagggaagaa
caggagaagctgaatgtctgggttgctcttctaaacttggagaacatgtatggcactgag
gagacactgatgaaggtctttgagagagctgttcaatacaatgaacctctgaaagtcttc
cagcatctgtgcgatatctatgccagttctgagaagtacaagcaagcagaagaattgtac
cacacaatgctgaggcgcttccgtcaggaaaaatcagtgtggctgaaatacgcctctttc
ctcctgaagcaaggccagactgaggctacacacaggcttttggagcgtgctctcaaggct
ctgcccaccaaagaacatgtggatgtcatttcaaggtttgcacagttggagttccgtttt
ggtgacccagaacatgccaaggccctgtttgaaagcactcttaacagctacccgaagcga
acagacatatggtctatctacatggacatcatgatcaaacagggcagccagaaggaaata
cgggacatctttgagagggtcatacacctgaacttagcaccaaagaagatgaaattcttc
tttaagcgctacctggattatgaaaagaaatatggtacaacagaaactgtcatggctgtt
aagacagcagcactagagtatgtggaggccaagagttcccttgctgacacctaa

DBGET integrated database retrieval system