KEGG   Gallus gallus (chicken): 423895
Entry
423895            CDS       T01006                                 

Gene name
GPAM
Definition
(RefSeq) glycerol-3-phosphate acyltransferase 1, mitochondrial isoform X1
  KO
K00629  glycerol-3-phosphate O-acyltransferase 1/2 [EC:2.3.1.15]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00561  Glycerolipid metabolism
gga00564  Glycerophospholipid metabolism
gga01100  Metabolic pathways
Module
gga_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    423895 (GPAM)
   00564 Glycerophospholipid metabolism
    423895 (GPAM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gga01004]
    423895 (GPAM)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     423895 (GPAM)
Lipid biosynthesis proteins [BR:gga01004]
 Phospholipid acyltransferase
  GPAT
   423895 (GPAM)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 423895
NCBI-ProteinID: XP_015144451
CGNC: 6675
Ensembl: ENSGALG00000008795
UniProt: E1BTI0
Position
6
AA seq 828 aa
MDETALSLGTIDVSYLSTSAECSVSRCKHSNEEWGECNSRPTLFRSATLKWKETLSRKRP
FVGRCCYVCTPQSRDNFFNASIPSLGLRNVIYINETHTRYRGWLARRLCYVLFVLERDVH
KGMFAKNLTENVLNSSRVQKAIVDEASEPSVPGSFAQMDPKAINKVKKKARKILQEMVAN
VSPALIRLTGWVLLKLFNSFFWNIQIHRGQIEMVKAATEMNLPLIFLPVHKSHIDYLLLT
FILFCHNIKAPYIAAGNNLNIPIFSTLIRKLGGFFIRRKLDQSSDGRKDFLYRALLYVHI
EELLRQQQFLEIFLEGTRSRSGKTSSPRAGLLSVVVDALFSNATPDVLIIPVGISYDRII
EGHYNSEQLGKPKKNESLWSIARGVFRMLRKNYGCVRVDFAQPFSLKEYVNSQSQKTVPA
PLSLEQALLPAILPSRPNDTVDEGTEASLPNSKDITSEPYRRELIANLAEHILFTANKSC
AVMSTHIVACLLLYRHRQGTDLSRLVEDFFSMKEEVLARDFDLGFSGNSDDVVMHAIHLL
GNCVNITNTSRNNEFFITPSTTIPAVFELNFYSNGILHVFIKEAVIACSLHAVQSKRFRN
GTNGASPSLISQEHLVRKAASLCYLLSNEFTVSLPCQLIYQVCHEAVEKLIQYGILLVAE
QDDQEDVSPSLTEQQWNKKLPEPLTWRSDEEDEDSDFGEEQRDCYLKVSQSQEHQQYITF
LQRLLGPLLEAYSSAVIFVHNFSGPVSESEYLQKLHRHLINRTEKNVAVYAESATYSHVK
NAVKVFKEIGVFIQTNQKRDTILELSTTFLPQRNRQKLLEFIMSFMVL
NT seq 2487 nt   +upstreamnt  +downstreamnt
atggatgaaactgctttgtcgcttggaacaatagatgtttcttatttgtccacctccgca
gagtgcagtgtcagtagatgtaagcattccaatgaagaatggggagagtgtaactctagg
cctactctcttccgatctgccactttaaaatggaaggagactctgagcagaaaaaggccg
tttgtgggacgatgttgctacgtatgcactccccagagccgggataacttcttcaatgct
agtattccttctttgggtctacgtaatgtgatatatatcaatgaaacacacaccaggtac
agggggtggcttgcaagacgactttgttatgttctttttgtgctagagagggatgttcat
aagggaatgtttgccaagaacctgacagaaaatgtgctgaatagcagtagggtacagaag
gccatcgtagatgaagcttctgagccaagtgttccaggtagctttgctcagatggatcct
aaggctatcaacaaagtgaaaaaaaaggctaggaaaattctccaggaaatggtagcaaat
gtgtcaccggctttaatcaggttgaccggctgggtgttactgaagttgtttaacagcttt
ttctggaatattcagatccacagaggtcaaatagaaatggtcaaagcagcaacagagatg
aatttgcctcttattttcttgcctgttcataaatctcacattgattacctgctccttaca
ttcatacttttctgccataacatcaaagcaccctatattgctgcagggaataatctcaac
atccccatcttcagcacactgatccgtaagctgggaggatttttcattcgtcgaaagttg
gatcagagttctgatggtcgtaaggacttcctctacagagctttgctgtatgtgcacata
gaagaattgttgagacagcagcagtttttagaaatattcttggaaggcacacggtctcga
agtggaaagacatccagtcctagagcgggtcttttatctgtggtagtggatgctctcttc
tcaaatgctactcctgatgtcctaattatacctgtgggaatctcctacgatcgcataatt
gaaggtcactataacagtgaacagctgggcaagcctaagaagaatgaaagtctttggagt
atagcaagaggagtcttcagaatgctgcggaagaattatgggtgtgtcagagtagatttt
gcacaaccattttccttaaaagaatatgtgaacagccaaagtcaaaaaactgtgcctgct
cctctttctcttgaacaagctttgttaccagctatacttccatcgagacctaatgatact
gtggatgaaggtactgaggcttcactgcctaactccaaggatataaccagtgaaccctac
agaagagagctgatagccaatttggctgagcatattttattcactgctaacaagtcctgt
gctgtgatgtctacccacattgttgcctgtttgctgctgtacagacataggcaggggact
gatctttccaggttggtggaagatttcttctccatgaaggaagaggtcttagcccgtgac
ttcgacttgggattttcagggaactcagatgatgttgtcatgcatgccatccacttgttg
gggaactgtgtaaatatcacaaacactagtcgaaacaacgagttcttcatcactcccagc
acaacgatccctgctgtctttgaactcaatttctacagcaatggaattcttcatgtattc
attaaagaggcagtcattgcctgcagtcttcatgcagttcagagtaagaggttcagaaat
ggtaccaatggtgcttctcccagcttgattagtcaagagcaccttgtccgcaaagctgcc
agcttgtgctacttgctttctaatgaatttactgtatctttgccttgtcagttgatatat
caagtttgccatgaagcagtggaaaagctgatacaatatggtattcttctggtggctgag
caggatgatcaggaggatgttagtcccagtcttacagagcagcagtggaataaaaaactc
cctgaaccattaacttggagaagtgatgaggaagatgaagatagtgattttggagaagag
caaagagattgctacctgaaggtcagtcagtctcaagagcaccagcagtacatcactttc
ctgcagaggttactgggacctttactggaggcatatagctctgctgtcatctttgtacac
aattttagtggtcctgtttcagagtctgaataccttcaaaagttacacaggcatttaata
aacaggacagagaagaatgttgctgtgtatgctgagagtgctacatacagccatgtgaaa
aatgcagtgaaagtctttaaggaaattggggttttcattcaaacaaatcaaaagagagac
actattttggagcttagcactacgttcctacctcagcgcaacaggcaaaaactactggaa
ttcatcatgagcttcatggtattatag

DBGET integrated database retrieval system