KEGG   Gallus gallus (chicken): 423937
Entry
423937            CDS       T01006                                 

Gene name
NSMCE4A
Definition
(RefSeq) non-structural maintenance of chromosomes element 4 homolog A
  KO
K22825  non-structural maintenance of chromosomes element 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    423937 (NSMCE4A)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     423937 (NSMCE4A)
SSDB
Motif
Pfam: Nse4_C Nse4-Nse3_bdg
Other DBs
NCBI-GeneID: 423937
NCBI-ProteinID: XP_421797
CGNC: 7232
Ensembl: ENSGALG00000009504
UniProt: F1NV66
Position
6
AA seq 395 aa
MAESDGSGDFFSPRGSGSARSRLSLPSASRNGSVSQRRQRRLSGGLGRPPASEKGDEEDE
EEEEDEDDGEEPESERPRPPGSSEGGGDERHRRLIRNQYRELICSVQQNREDMLSSKSNR
LTEALEEANQLFSGVSRAREAALDAQFLVLASNLGKEKANELRSEITTFDSLTFAEDLLT
FMGINRTETEGNDSDSESMSGGYLPSNAWYKLGEEAEKYFRRAPSFHYMLGSFKSEPPMP
RQRIERQRKAPGGEEKRAMPAQLKKMEESHQEATAKEVERILGLLQTHFRNDPCTPIFFF
DLVVDPNSFARTVENIFHVSFILRDGLARLKLDDDKLPVIEPVQNVEERNDDHSARARNQ
VVISLSHEEWREIVETYEITEPMISPPNSDEMETA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggccgagtcggatggaagcggcgatttcttctccccgcggggctccggctccgcccgc
agccgcctctcgctgccgtccgcctctcgcaacggctccgtctcgcagcgcaggcagcgg
cggctctcgggcggcctgggccgcccgccggcctccgagaaaggggacgaggaggatgaa
gaggaagaggaggacgaggacgacggagaggagccggagtccgagaggccgcggccgccg
gggagctccgaaggcggcggcgacgagcgccacaggaggctgatccgcaaccaataccgg
gagctcatctgcagcgtgcagcaaaatcgtgaggatatgctgagttccaagagcaacagg
ctgacagaagctttggaggaagccaatcagctattcagtggagtttcccgtgcacgagaa
gctgctctggatgcccaatttcttgtcttggcatcaaatctagggaaggagaaagccaat
gagttgcgctcagagatcacaacgtttgattcactaacatttgcagaagatctgctgaca
ttcatgggtataaatcgcacagaaacagagggaaatgatagtgattctgagagcatgtca
ggtggctatttacctagtaatgcctggtataagctgggagaagaagcagaaaagtacttc
aggagagcaccttcttttcattacatgttgggatctttcaagtctgaacctcccatgccc
aggcaacggattgagaggcagagaaaggctccaggaggagaagaaaaacgggcaatgcct
gctcagctaaaaaaaatggaggagtctcatcaagaagctacagcaaaagaagtggagagg
atcttgggattgttacagactcattttagaaatgatccttgtactcctattttcttcttt
gatcttgtggttgatccaaactcctttgcgcgcactgtggaaaacatcttccatgtgtcc
ttcatactaagggatggtttagcaagattaaagctggatgatgataaattgccagtaata
gagcctgtacagaacgttgaagaaagaaatgatgaccacagtgctcgagcacggaaccaa
gttgtcatttccctgagccatgaagaatggagggaaattgtagaaacatatgagataaca
gaacctatgatcagccctcctaatagcgatgaaatggagacagcttaa

DBGET integrated database retrieval system