KEGG   Gallus gallus (chicken): 423958Help
Entry
423958            CDS       T01006                                 

Gene name
CTBP2
Definition
(RefSeq) C-terminal-binding protein 2
  KO
K04496  C-terminal binding protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
gga04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    423958 (CTBP2)
   04330 Notch signaling pathway
    423958 (CTBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    423958 (CTBP2)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Macropinocytosis
   Others
    423958 (CTBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 HHH_5
Motif
Other DBs
NCBI-GeneID: 423958
NCBI-ProteinID: XP_015144539
CGNC: 52095
Ensembl: ENSGALG00000009738
Position
6
AA seq 842 aa AA seqDB search
MPIPSKHPNIGRSQSWDASGWYEGAWEGENAFEYQRPPGRRSSLTYGGEGGWYEPPGLRA
NDIILQGGAELKQEAYPYQDAAFAPGPLRKGSVPDFTYCDRQAVMAGRGTQDYYSDPSLA
ARSPKDPRCYQAVSRPLAGYGAPGSRLSWDQAPGRPPAPPEAARLYRDPKMAMDGQRLRN
RDVSPARYGTEPPSLRYGAEPPNFPGRPAYGDGAERPPEAAGSRQAVPTCLVVDPAGGYG
PGREGTGTKGPYDSYETMAVAPTHPPVPTAFPGQEGKRSFDPEFVALLRAEGVSESTFAA
LLQQGFDSPNLLAMMEENDIKSVAPNLGQARVLSRIAHNYKAEMQLQRQERRSGSLRPRT
RSNSFSHRGELPGDYGLSMGSGPAADGLAAPQPPLQPPSPRAGEMHRRPSSAPTQHLLET
TYPTGTPQGPQFLSNSGYNTPLPCNVHPRPASTYSAPSGTPMATANPHASPKTAYPTTYT
VPMELMKRERTAASPAPSPHGSPQLLRRPGAPGDSSLAPAGPAFPAQLSPYPKLSRRTGP
PVIVSTMASPEPSIRPQIMNGPMHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQE
IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNIDIKAAGELGIAVCNIP
SAAVEETADSTVCHVLNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIG
FGRTAQAVAVRAKAFGFNVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNE
HNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALTQALKEGRIRGAALDVHESEPFSFAQ
GP
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccccagcaagcaccccaacatcggccgctcgcagagctgggatgcctccggt
tggtacgagggcgcctgggagggtgagaatgccttcgagtaccagaggccgccaggccgg
aggagctccctgacctacggtggtgagggtggctggtatgagccgccgggcctccgtgcc
aatgatatcatcttgcagggcggtgcggagctgaagcaagaggcgtacccctaccaggat
gctgccttcgccccagggcccctcaggaagggctctgtccctgacttcacctactgtgac
cggcaggcagtcatggccggacggggcacccaggattactacagcgacccgtccttggcc
gctaggtcacccaaggaccctcgttgctaccaggcggtaagccggccactggcgggctac
ggagcgccaggcagccgactgtcttgggaccaggctccgggccgcccgcctgcaccccca
gaggctgcccgcctctacagggaccccaaaatggccatggatgggcagcgactgcgcaac
cgggacgtctcgccagcacggtatggcacggagccccccagcctgcggtatggagcggag
ccaccgaacttccctggccgtccagcctatggcgatggtgctgagcggcctcctgaggca
gcgggcagcagacaagccgtccccacatgtctagtggtggatcccgctggtggctatggg
ccaggccgggagggcaccggcaccaagggcccgtacgacagctacgagacaatggcggtg
gcaccaacccacccgccagtgcccacggccttccccggacaggaggggaagaggagcttc
gaccctgagtttgtggcattgctgcgtgccgagggcgtctcggagagtacctttgctgct
ctgctgcagcagggcttcgactcgcccaacctgctggccatgatggaggagaacgacatc
aagtcggtggctcccaacctggggcaggcacgtgtgctgtcacgcatcgcccacaactac
aaggccgaaatgcagctgcagcggcaggagcggaggagtggatcgctgcgccccaggact
cgctccaacagcttcagccaccgcggagagctgccgggtgactacgggctgagcatgggc
tcgggaccggctgccgacggcctcgcggccccacagcctccattgcagccaccctcccca
agggccggggagatgcaccggcggccatccagcgcccccacccagcacctactggagacc
acctaccccaccggcactccgcaggggccgcaattcctctccaattccggatacaacacg
cccctgccttgcaacgtgcacccacggccggcgtccacctattccgctccttctggcaca
cccatggccacagccaacccacatgccagccccaaaacggcgtacccaaccacctacact
gtgcccatggagctgatgaagagagagcggacggcggcatcaccagcccccagcccacat
ggcagcccgcagctcctccgccggccaggtgcacccggggacagcagcctggcacccgcc
ggccccgcgttccctgcacagctctccccgtacccgaagctcagcaggcgcacggggcct
cctgtcattgtctccacgatggcatcgcccgaaccaagtatccgtcctcagatcatgaac
ggccccatgcacccccggcccctggtggcactgctggatggcagggactgcacggtggag
atgcccattctgaaggacttggcgaccgtggcgttctgtgatgcacaatcaactcaggag
atccacgagaaggtattaaacgaagctgttggggcgatgatgtaccacaccatcacgctg
actcgagaagacctggagaagttcaaggccttgcgggtcattgttcgaataggcagcggc
tacgacaacatcgacatcaaagcggcgggggagctcgggatcgccgtctgcaacatcccc
tcggccgccgtggaggagacggccgactccaccgtctgccacgtcctcaacctctaccgg
cggaacacgtggctctaccaggcgctgcgggagggcacgcgggtgcagagcgtggagcag
atccgggaggtggcctctggtgctgcacgtatccggggcgagacgctcggcctcatcggc
ttcggtcgcacggcgcaggcggttgcggtccgagccaaggcgttcggcttcaacgtcata
ttctacgacccgtacctgcaggatggcatagagcggtccctgggagtccagcgggtgtac
acgctccaggacctgctctatcagagcgactgcgtctcgttgcactgcaaccttaacgaa
cacaaccaccacctcatcaacgacttcacgattaagcagatgaggcagggagcgttcctg
gtgaacacggcgcgcggtgggctggtggatgagaaggccttaactcaagccctgaaggag
ggtcggatacgaggggctgcgctcgacgtgcacgagtcggaacccttcagttttgctcaa
ggcccatga

DBGET integrated database retrieval system