KEGG   Gallus gallus (chicken): 423974
Entry
423974            CDS       T01006                                 

Gene name
OPNVA
Definition
(RefSeq) vertebrate ancient opsin isoform 3
  KO
K04256  c-opsin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    423974 (OPNVA)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    423974 (OPNVA)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     423974 (OPNVA)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Vision
   Opsin
    423974 (OPNVA)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srv TAS2R 7tm_4
Other DBs
NCBI-GeneID: 423974
NCBI-ProteinID: NP_001098788
CGNC: 52098
Ensembl: ENSGALG00000010513
UniProt: A7M6L0
Position
6
AA seq 280 aa
MPCLWLPPLSFASSCDSFSWLCFASMQNILKYSKRENQSSPGIVALWSLALLAFERYIVI
CRPVGNMRLRGKHAAQGIAFVWTFSFIWTIPPTMGWSSYTTSKIGTTCEPNWYSGAYNDR
SYIIAFFTTCFIVPLLVILVSYGKLLQKLRKVSNTQGRLRTARKPERQVTRMVVVMIIAF
LICWMPYAVFSILATAYPSIELDPHLAAIPAFFSKTATVYNPIIYVFMNKQFRMCLIQMF
KCSAIETAESNMNPTSERATLTQDKRDSQLSVMAVRSTIS
NT seq 843 nt   +upstreamnt  +downstreamnt
atgccatgcctgtggttgccacccctctcatttgcttcttcctgtgattctttctcttgg
ctttgttttgcaagtatgcaaaacatattgaagtactctaaaagggaaaatcaatcatca
ccaggcattgtggctctctggtctcttgctcttttggcttttgagcggtacattgtgatc
tgccgcccagtgggaaatatgcgcttgagagggaagcatgctgcccaaggtattgctttt
gtgtggaccttttccttcatttggaccattccaccaaccatgggttggagcagctacacc
accagtaagattggaactacttgtgagcctaattggtattcaggagcttataatgatcgt
tcctacattattgcattcttcaccacctgttttatagtgcctttattggtaattctggtg
tcgtatgggaaactgctgcagaagctaagaaaggtgtcaaatacacaaggcaggttgaga
actgccaggaaacctgaaagacaagtgactagaatggtggttgttatgatcattgctttt
ctaatctgctggatgccatatgccgtcttttctatcctagccactgcatacccttccatt
gaactggatcctcacctggcagcaattccagctttcttttccaaaacagctactgtttat
aatccaattatttatgtttttatgaacaaacagttcaggatgtgtctgattcagatgttc
aagtgtagtgccatagagactgcggagtccaacatgaacccaacttcagagagagcaaca
ctcacccaagacaaaagagacagtcagttgtctgtcatggcagtacgaagcaccatttct
tag

DBGET integrated database retrieval system