KEGG   Gallus gallus (chicken): 423986
Entry
423986            CDS       T01006                                 

Gene name
COL5A2
Definition
(RefSeq) collagen alpha-2(V) chain isoform X2
  KO
K19721  collagen type V/XI/XXIV/XXVII, alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    423986 (COL5A2)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   423986 (COL5A2)
SSDB
Motif
Pfam: Collagen COLFI VWC Amnionless TILa
Other DBs
NCBI-GeneID: 423986
NCBI-ProteinID: XP_004942453
CGNC: 1798
Ensembl: ENSGALG00000031112
UniProt: A0A3Q2UBM2
Position
7
AA seq 1496 aa
MMAIRVEMRTFFILAALLGLFVTIKAQEEEDYDAGEDVEEIACTQNGQMYLNRDIWKPSP
CQICVCDNGAILCDEIQCQDVLECENPQVPPGECCPVCPHTARDFDPTVGRGRKGQKGEP
GIVPPVSGIRGRPGPAGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGIPGQPGDPGPPGH
PTHTGPDGLSRPFAAQMAGLDEKSGLGSQMGLMPGAVGPVGPRGPQGLQGKQGGAGPTGP
PGEPGDPGPMGPVGSRGPEGPPGKPGEDGEPGRPGQSGEPGFPGSPGPRGFPGAPGLPGL
KGHRGLKGLDGPKGEIGAAGAKGESGPTGAMGATGPLGPRGMPGERGRIGPQGAPGGRGQ
HGMPGKPGPMGPLGITGSPGFPGAPGMKGEAGPTGPRGPEGPQGQRGETGPQGPAGSQGL
PGTEGTDGSPGAKGPTGSPGTGGPPGLLGPPGSPGPQGSTGPPGIRGQPGDPGVPGFKGE
AGPKGEPGPQGPQGPIGPIGEEGKRGPRGDPGSVGPPGPVGERGAPGNRGFPGSDGLPGP
KGAQGERGPAGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGGPGEDGR
PGPAGSIGIRGQPGSMGLSGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGP
PGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGVVGPLGPRGERGNPGE
RGEPGASGLAGEKGMAGGHGPDGPKGSPGPSGTPGDPGPPGLQGMPGERGIAGTPGPKGD
RGGMGEKGAEGTAGNDGARGLPGPIGPMGPAGSTGEKGEPGPRGLVGPPGSRGNPGSRGE
NGPTGAVGFAGPPGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPPGPSGVPGLKGG
RGTQGPPGATGFPGSAGRVGPPGPTGAPGPAGPIGEPGKEGPPGLRGDPGSHGRVGDRGP
AGPPGGPGDKGDAGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGK
QGPTGPPGDKGPPGPIGQSGATGPVGEAGPEGPAGNDGTPGRDGAVGERGDRGEPGPAGL
PGSPGGPGTPGPVGPPGDAGQRGETGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGD
RGQKGHRGFTGLQGLPGPPGPIGEQGSPGIPGPFGPRGPPGPVGPSGKDGSPGPLGPIGP
PGVRGSVGEAGPEGPPGDPGPPGPPGPPGHLTAAIGDIMGHYDDAMADPLPEFTEDEAAP
DDHNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHPSKKSGEYWIDPNQG
CVEDAIKVYCNMETGETCISANPSTIPRKTWWASRSSDLKPIWYGLDMNRGSQFVYGDTA
VTQMTFLRLLSKEASQNITYLCKNSVGYMDDQTKNLKKAVILKGANDLEIKAEGNSRFRY
TVLQDSCSKRNGNVGKTVFEYRTQNVARLPIIDIAPVDVGSTDQEFGIEIGPVCFV
NT seq 4491 nt   +upstreamnt  +downstreamnt
atgatggcaatcagggtagaaatgagaacttttttcatccttgccgctttattagggcta
ttcgtcaccataaaagcacaagaagaggaagattacgatgctggagaagatgttgaagag
attgcctgcactcagaatggccagatgtacctgaacagggatatttggaagccctcaccg
tgccagatttgtgtctgtgacaacggagctattctttgcgatgaaatccagtgtcaagat
gtgttggagtgtgagaacccacaggtgcccccaggagagtgctgtccagtgtgtccccat
accgcacgtgattttgaccctaccgttggcagaggaagaaaggggcaaaaaggagaacct
ggaatagtgccacctgtttcaggaatacgaggccgcccagggcctgcaggacctcccggt
tcacagggaccacggggagaacgaggacctaagggaagacctggtcctcgtggtcctcaa
gggattgatggagaacccggtatccctggccagcctggtgaccctggtcctcctgggcat
ccaactcacacaggaccagatgggctaagcaggccatttgcagctcagatggcaggtctg
gatgaaaaatcaggacttggtagtcagatggggctgatgcctggtgctgtgggtccagtg
ggtccaagaggtcctcaaggtcttcaaggaaaacaaggtggtgctggccccacaggccct
cctggtgaacctggagatccaggacctatgggtccagttggttcacgtggaccagaaggg
cctccaggcaaacctggtgaagatggtgaacccggtagaccaggacagtctggtgagcct
ggatttccaggatctccagggcctcgaggctttcctggtgctccaggtcttccaggtctc
aagggtcacaggggattgaaaggtctcgatggtccaaaaggtgaaattggagcagctgga
gcaaagggagaatctggaccaacaggtgccatgggtgcaacaggtcccctaggacctaga
ggaatgccaggagaaagaggtcgaattggaccacagggtgcccctggtggacgtggtcag
catggcatgcctggaaagcccgggccaatgggtccccttggcataactggttctccaggt
tttccaggcgctcctggtatgaagggagaagcaggtccaaccggtcctcgtggtcctgaa
ggccctcaaggacaaagaggtgaaactggtccacaaggcccagctggatcacaaggtctt
cctggtacggaagggacagatggctctccaggtgccaaaggcccaactggatctccaggc
actgggggcccccctggcttattgggtccacctggttccccaggaccacaaggcagtaca
ggcccacctggtattcgagggcagccgggagatcctggagttccaggtttcaagggagaa
gcaggacccaaaggtgaaccaggcccgcaaggtccccaaggtcccattggccccataggt
gaagaagggaaaagaggccctcgaggtgatccagggtcagtgggtccaccaggtccagtt
ggagagaggggtgctcctgggaaccgtggttttccaggttctgatggcttgcctggacca
aagggtgcccaaggagagcgtggtccagcaggttcttctggtcctaaaggaggtcaggga
gatcctgggcgtcctggtgagcctggactcccaggtgcaaggggtttgacaggaaatcca
ggtgttcaaggccctgaaggaaaacttggccccttgggtggccctggagaagatggacgt
cctggtcctgcaggttcgataggaatcagaggtcagccaggcagtatgggcctttctggg
ccaaagggtagtagtggtgatcctggtaaaccaggagaagcaggaaatgcaggtgttcca
ggacaaagaggagctcctggcaaagacggtgaagtcggtccttctggtcctgttggccca
ccaggcctggcaggagaaagaggagaacaaggccctccaggtcctacagggtttcagggc
ttacctgggcctccaggtcctcctggtgaaggaggaaagccaggtgatcagggtgttccc
ggagatcctggagttgttggtccattgggtcccaggggagaacgtggcaacccgggggaa
cggggagagccaggtgcatcaggacttgcaggtgaaaagggtatggctggaggtcatggt
cctgatgggccaaagggaagcccaggccctagtgggacgcctggtgatccaggcccacca
ggtcttcaaggtatgcctggagaaagagggattgctggaactcctggtccaaagggtgac
agaggtggtatgggtgagaaaggtgctgaaggtactgctggcaatgatggggcaagaggt
cttcctggtccaataggcccaatgggtccagcagggtccactggagaaaagggtgaacca
ggtcctcgaggtcttgttggtcctcccggttctcgtggaaaccctggttctcgaggagaa
aatggcccaactggtgctgttggttttgctggtcctccaggccctgatggtcagccgggt
gtgaaaggtgaacctggggaacctggacagaaaggagatgctggatctccaggaccacag
ggtcttgctggatctcctggtccaccaggtccttcaggtgttcctggtctgaaaggtggt
cgaggaacccagggtccccctggtgctactggattccctggatctgctggaagagttgga
cctcctggacccactggagctccagggcctgctgggcctattggtgagccaggaaaagaa
ggtcccccaggtcttcgtggtgatcctggttctcatggtcgtgtgggtgatcgaggacca
gctgggccccctggtggtcctggagacaagggtgatgcaggagaagatgggcaaccgggt
ccagatggccccccaggtccagcaggaactactggtcaaagaggtattgttggtatgcca
ggacagcgaggggaaagaggcatgccaggactgccaggtcctgcaggtacaccaggaaaa
caaggtcccacagggccacccggtgataaaggtcccccaggacctattggccaatcaggt
gccactggacctgtaggggaagctggtccagaaggacctgctggtaatgatggtactcca
ggacgagatggagctgttggagagcgtggtgatcgtggtgaacctggccctgcaggccta
cctggttctccaggaggtcctggaactccaggtcctgttggccccccgggagatgcaggt
caaagaggtgaaactggttctcgagggccagtgggtcccccaggccgtgcaggaaaaaga
ggtttgcctggtccccaagggcctcgtggtgacaaaggtgacaatggagatcgaggtgac
aggggccagaaaggacacagaggtttcactgggcttcaaggtcttcctggtcctcctggc
cctattggtgaacagggcagtcctggcattccaggcccatttggtcctcggggtcctcca
ggtccagttgggccttcaggcaaagatggaagtcctggaccactagggccgattgggcct
cctggtgttagaggaagtgtaggagaagctgggcctgagggtccaccaggtgatcctggc
cctcctggtccccccggccctccaggtcacctcactgctgccattggtgacattatggga
cactatgatgatgctatggcagatccactaccagagtttactgaagatgaagcagctcct
gatgaccacaataaaacagacccaggagtccatgccacgctgaagtcactgagcagccag
attgagactatgcgcagcccagatggttcgaagaaacacccagcacggacttgtgatgac
ctgaagctgtgccacccatccaagaagagtggtgaatattggattgatcctaatcaggga
tgtgttgaagatgctataaaagtatactgcaacatggaaactggagagacctgcatttct
gcaaatccatcaactatcccacgtaaaacatggtgggccagcagatcatctgacttgaag
cccatttggtatggccttgatatgaacaggggatcacagtttgtgtatggggatacagct
gtcactcaaatgacattcctgcgcctcctgtcaaaggaagcttcccagaatatcacttac
ctctgtaagaacagtgttgggtacatggatgaccaaactaagaacctcaagaaagctgtc
attctgaaaggggccaatgacctggagatcaaggcggagggaaacagccgattcagatac
actgttcttcaagacagctgttctaaacgtaatggcaacgtgggcaagacggtctttgag
taccgaacgcagaacgtggcacggttgcctatcatagatatcgcaccagtggatgttggc
agcactgaccaggaatttggaattgaaattgggccagtttgttttgtgtaa

DBGET integrated database retrieval system