KEGG   Gallus gallus (chicken): 424010
Entry
424010            CDS       T01006                                 

Gene name
BARD1
Definition
(RefSeq) BRCA1-associated RING domain protein 1
  KO
K10683  BRCA1-associated RING domain protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    424010 (BARD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    424010 (BARD1)
   04121 Ubiquitin system [BR:gga04121]
    424010 (BARD1)
   03036 Chromosome and associated proteins [BR:gga03036]
    424010 (BARD1)
   03400 DNA repair and recombination proteins [BR:gga03400]
    424010 (BARD1)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     424010 (BARD1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    424010 (BARD1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     424010 (BARD1)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     424010 (BARD1)
SSDB
Motif
Pfam: zf-RING_6 Ank_4 Ank_2 Ank_5 Ank Ank_3 BRCT_2 BRCT zf-RING_5 zf-C3HC4 zf-C3HC4_2 NIBRIN_BRCT_II zf-C3HC4_4 zf-RING_UBOX PTCB-BRCT zf-RING_10 zf-RING_2
Other DBs
NCBI-GeneID: 424010
NCBI-ProteinID: NP_001026417
CGNC: 2541
Ensembl: ENSGALG00000003484
UniProt: Q5ZKJ1
Position
7
AA seq 750 aa
MARPWAHTRAALERLERALSCSRCAGVLREPVSLGGCEHVFCLSCMGDHVGKGCPVCHVP
AWVQDMQINRQLDDMVQLCGKLRHLLDAGTSDSMESTPTPMCSDFGENSKKGQIKMWFSP
RSRKIRCIVNKNQPKTNSNDLCQDPSSVYHFFPSPVHEKPSKPRKKPTQRQSKKMKKKRL
ADINKAWGLEKPEQKGGVEEKASKEKCVTICNEPVVLCTPEQHSPKETLPQESIQEVDST
KNLVEVEVSPEVKSSQEEDNSKAVCPVQVSKETNCAAEKSPSIESKAMHLKRGREQSKLP
GTSQTKRRRSEGSLNRNSDSQTSCSEDLSQDCPIPQVTEPRTPVQVCGSAMKTRSSAASS
PLLPKSPSTPSTFKACDQVGIPQSPSVFKSPGSNPIARRNYKGETLLHIASIKGDLAAVE
ELLKNGADPNVKDNAGWTPLHEACNHGHQEVVELLLQHKALVNSTGYQNDSPLHDAAKNG
HVSIVELLLLHGASRDAVNIFGLRPVDYAESEKMKSVLMLPVKNESFSFSQPSESPSQPR
DGPLGILGSGLSSKQQKLLNKLATVLKARRCTEFNSTVTHVVVPDVPMPSTVKCMMAVLS
GCWVLKFEWVQACLQSTVREQEEKYEIQGGPQRGRLNREQLLPKLFDGCYFYFLGSFNSH
QKSDLVELVKAGGGQILVRQPKPDSDVTQTINTVAYHAESTSDQRFCTQYVIYDASSKFK
PEKIRQGKVWFAPSSWIVDCIMSFQLLPVK
NT seq 2253 nt   +upstreamnt  +downstreamnt
atggcgcggccttgggcgcacacccgagccgcgctggagaggctggagagggcgctgagc
tgctcccgctgtgctggcgtgctgcgggagcccgtgtccctggggggctgcgagcacgtc
ttctgcctatcttgcatgggcgaccatgttggcaaagggtgcccggtgtgccacgtgcca
gcctgggtgcaagacatgcagataaaccgtcaactggatgacatggtccagctctgcggc
aaactgcggcatctcctggatgcaggcacctcagattcaatggaatctacgcctacacca
atgtgctcagacttcggagaaaacagtaagaagggacaaatcaaaatgtggttcagcccg
agaagtaggaagattcgatgcatcgtgaacaagaatcagccaaagactaacagtaatgac
ctttgtcaagacccatcttcagtttatcatttctttccttcccctgttcatgaaaagccc
tccaaaccaagaaaaaaaccaactcagaggcagagtaagaagatgaagaaaaaacgtcta
gcagacatcaacaaagcgtggggtttagagaagcctgagcaaaaaggaggggttgaggag
aaggcttccaaggaaaagtgtgtgaccatttgcaatgagcctgtcgtcctgtgcactcca
gagcaacatagccccaaagagacacttccacaggaatctatacaggaagttgactccacc
aaaaacttggtagaagtggaagtatctccagaggtgaaatcctcacaggaggaagataac
agtaaggctgtctgtcctgtacaagtcagcaaggaaacaaactgtgctgcagagaaatca
ccatcaatagaaagcaaagcaatgcatttgaaacgtggaagggagcaatcaaaactccca
ggtacttctcagacgaaaagacgaagaagtgaggggagccttaacaggaattcagacagc
cagacttcttgctcagaggacttgtctcaggattgccctatcccccaagtgaccgaaccc
aggacacctgttcaggtctgtggcagtgcaatgaagacgagaagctctgcagcaagtagt
cctttacttccaaaatctccctctactccatctactttcaaggcttgtgatcaagtagga
ataccacagagtccttctgtgttcaagtcccctggtagtaacccaattgccagaagaaat
tacaaaggggagactttgctccatattgcttccatcaagggtgacttagcagctgttgaa
gagctgctgaaaaatggggcagatcccaatgttaaggacaatgctggctggacaccactg
catgaggcatgtaaccatgggcaccaagaggtggtggagctgttgttacaacacaaagca
ctggtgaattctacaggctatcagaacgattcgccccttcacgacgctgccaagaatggg
cacgtgagcattgttgagctgctgcttctgcatggtgcctcccgtgatgcagttaatata
tttggtctgcggcctgtggactatgcagagagtgaaaagatgaagtctgtgctaatgtta
ccagtcaagaatgaatcattttcatttagccagccttctgagagcccaagccagcctaga
gacggacctcttggtatcctggggagcggtcttagttcaaaacaacagaagttgctgaac
aagctagcaacagttctgaaggctcgaaggtgtactgaatttaacagcacagtaacccac
gttgttgttcctgatgttccaatgccaagtactgttaaatgtatgatggctgttctgtct
ggatgttgggtcctgaagtttgagtgggtacaagcctgtctacaaagtacagttcgagaa
caagaagagaagtatgaaatccaaggtggcccacaaagaggccgtctcaacagagaacag
ctgctgcctaagctgtttgatggatgctacttctattttttgggatctttcaatagtcac
cagaagagcgatcttgtggagctggtcaaagcaggaggagggcaaatcctggttaggcag
ccaaaaccagacagcgacgtgacgcagacgatcaacacggtggcataccatgcagaatcg
acttctgaccagagattttgcactcagtatgtcatctatgatgcatcttctaaattcaaa
ccggagaaaattcgtcaaggcaaagtctggtttgctccctccagttggatcgtagactgc
ataatgtcatttcagctgctgcctgtaaagtga

DBGET integrated database retrieval system