KEGG   Gallus gallus (chicken): 424030
Entry
424030            CDS       T01006                                 

Gene name
ASB1
Definition
(RefSeq) ankyrin repeat and SOCS box protein 1
  KO
K10323  ankyrin repeat and SOCS box protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    424030 (ASB1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     424030 (ASB1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_4 Ank_5 SOCS_box
Other DBs
NCBI-GeneID: 424030
NCBI-ProteinID: XP_004942570
CGNC: 3141
Ensembl: ENSGALG00000004272
Position
7
AA seq 351 aa
MAEGSPPGGGAAPSGGGEAAGALSAPGGPAGRNLKEWLREQFCDHPLEHCEDTRLHDAAY
VGDLPTLKSLLEEESFQSRINEKSVWCCGWLPCTPLRIAATAGHGPCVDFLLQKGAEIDL
VDVKGQTALYVAVVNGHLECAKILLEAGADPNGSRHHRSTPVYHAARVGRADILQELIRY
GADVDVNHHLASRVSSPSLRPLTTLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCRGPI
NIQGFSRGSPVCVMDAVLRHGCEAAFIHLLIDFGANLNLVKVEALEFDSTGRVKVNPEAL
QVFKEARGRARSLLSLCRIAVRRILGKSRLDLIHILPVPDPIKQFLLHEHS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgagggcagtccccccggcggtggggccgccccgagcggcggcggggaagctgcg
ggcgccctcagcgccccgggcgggcccgcaggtcggaatctgaaggagtggctgcgggag
cagttctgcgaccaccccctggagcactgcgaggacacccggctacacgatgcagcctac
gtgggggatctgcccacgctgaagagcttgctggaggaggagagcttccagagccggatc
aatgaaaagtcggtgtggtgctgtggctggctgccctgcactcctctgcgcattgccgcc
accgctggccatggcccctgtgtcgacttcctcctccagaaaggggctgagatcgacctg
gtggatgtgaaggggcagaccgccctctacgtggctgtggtcaacgggcacctcgagtgt
gccaagatcctgctggaagctggagctgaccccaatggcagccggcaccatcgcagcact
cctgtctaccatgcagcgcgcgtgggccgggcagacatcctccaggagctgatcagatat
ggtgcagatgtggatgtgaatcaccacctcgcttctcgggtctccagcccctccttgcga
cccctcaccacacttgtggtctgtccactatacatcagtgctgcctaccacaaccttcag
tgcttccggctgctgctccaggctggagccaacccagattttaattgccgtgggccaatc
aacatccaaggcttctctcggggctcacccgtgtgtgtgatggacgctgtcctgcggcat
ggctgtgaggcggcattcatccacctcttgattgactttggagccaacctgaacctggtg
aaggtggaggccttggaatttgactccacggggagggtcaaagtcaaccctgaggctctg
caggtcttcaaagaagcacgaggccgcgcccggagcctgttgtctctctgccgcatagct
gttcgaagaatacttggcaaatctcgtctggatctgatccatatccttccagtcccagac
cccattaaacaatttttacttcatgaacacagttaa

DBGET integrated database retrieval system