KEGG   Gallus gallus (chicken): 424044
Entry
424044            CDS       T01006                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04217  Necroptosis
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    424044 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    424044 (STAT1)
   04621 NOD-like receptor signaling pathway
    424044 (STAT1)
   04625 C-type lectin receptor signaling pathway
    424044 (STAT1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    424044 (STAT1)
   05168 Herpes simplex virus 1 infection
    424044 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    424044 (STAT1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    424044 (STAT1)
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra NPV_P10
Other DBs
NCBI-GeneID: 424044
NCBI-ProteinID: NP_001012932
CGNC: 52118
Ensembl: ENSGALG00000007651
UniProt: Q5ZJK3
Position
7
AA seq 755 aa
MTQWYQLQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLENQDWEHAANNVSFATVLFHDL
LSQLDDQFSRFLIENNFLLQHNIRKSKRNLQDNFQEDPIHMAMIIHNCLKEERKILNSAQ
LSNQMEVGGVQNTMTGMLDKQKELDAKVKAVKNSVTDVEQDIKTLEDVQDEYDFKHKTFQ
NREYEPNGASQEECKKEQMNLQKMFFLLDIKRKEVVAKIIQLLNTTEHTQSALINEELVE
WKRRQQTACIGGPPNACLDQLQNWFTIIAESLQQVRQQLKKLEELEQKLTYDPDPITKNK
QVLQDRTHSLFKQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNL
KVKVLFDKDVNEKNSVKGFRKFNILGTNTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNR
TNEGPLIVTEELHSLSFETQLCQPGLVIELETTSLPIIVISNVSQLPSGWASILWFNMLS
TDPKNLSFFLNPPCAKWSKLSEVLSWQFSSVTKRGLNADQLNMLGEKLLGPTSGGSHDGL
IPWTRFCKENINDKNFPFWLWIEGILELIKKHLLCLWNDGCIMGFISKDKERALLKDQRP
GTFLLRFSESSKEGAITFTWVEGSQNEPQFHSVEPYTKKELSAVTFPDIIRNYKVMAAEN
IPENPLRFLYPDIPKDNAFGKYYSRPKEAPEPMDTDTPKGNGYIRTELISVSEVHPSRLQ
SPENLLPMSPEEFDEVSRMVDPAEIDTVMCSAYTA
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgactcagtggtaccagctacagcaacttgactccaagtttttggagcaagttcaccag
ctgtacgatgacagctttcctatggaaatcaggcagtacttggcacagtggctggaaaac
caggattgggaacacgcagccaacaacgtatcttttgctacagtgctattccatgacctg
ctgtcacagcttgatgatcaatttagccgatttttgatagaaaacaactttttgctgcaa
cacaacataaggaaaagcaaacgtaatcttcaggataacttccaagaagacccgatacac
atggcaatgataattcacaactgtctgaaagaggagagaaaaattttgaacagtgcacaa
ttgtctaatcagatggaagtgggaggtgtacagaacaccatgactgggatgctggataaa
cagaaggagcttgatgcaaaagttaaggctgtaaaaaacagtgttacagatgtagaacaa
gacatcaagacattagaggatgtgcaagacgaatatgactttaaacataaaaccttccag
aatagagagtatgagcccaatggtgcatcacaagaggaatgtaagaaagagcagatgaat
ctccaaaagatgtttttcttacttgacatcaagagaaaggaagtggtggccaagataata
cagctcttgaacaccacagagcacacacagagtgctcttattaacgaggagctggtggag
tggaaacgtaggcaacagactgcatgcattggtggcccacccaatgcctgtcttgaccag
ctacagaactggttcaccatcattgctgaaagcctgcagcaagttcgtcagcagctcaaa
aagcttgaggaactggagcagaaacttacttatgaccctgaccctatcacaaaaaacaaa
caagttttgcaggaccgaacgcacagtcttttcaaacagcttatccagagctcctttgtg
gtagagaggcagccttgcatgccaacacatccacagaggccattagtcctgaagacaggg
gtacagtttactgtgaagctgagattactggtgaaattgcaggaattgaactacaacctg
aaagtgaaagttctatttgataaagatgtaaatgagaagaactcagtcaaaggattcagg
aaatttaatattctgggaacaaatacaaaagtaatgaacatggaagaatctactaatgga
agtttagcagcagaattcaggcacttgcaactgaaagaacagaaaaatgcagggaacaga
acaaatgagggtcctcttattgtaacagaagaacttcactctctgagtttcgagacacag
ctgtgccagcctggcttagtaatagagctagagaccacatcacttcccatcattgtcatc
tctaatgtgagccagcttccaagcggatgggcttctatcttatggttcaacatgctgtct
actgatcccaagaatttgtccttctttctaaacccaccttgtgcgaagtggtctaaactt
tctgaagttctgagctggcagttttcttctgtgacaaaaagaggacttaacgcggatcag
ctgaacatgctgggagagaaactacttgggccaacaagtggaggatctcatgatggcctt
attccttggacaagattctgtaaggaaaacataaatgataaaaatttccctttttggctg
tggatagagggaatcctggaacttattaagaaacatctcctatgcctctggaacgatggc
tgtatcatgggtttcatcagtaaagacaaagaacgtgctttattgaaggaccagagacca
ggaacatttttactgagattcagtgaaagcagtaaagagggagcaatcacttttacctgg
gtagaaggatctcaaaatgagccccagttccactcagtagaaccatacaccaagaaggag
ctctctgctgttactttccctgatatcattcgcaactacaaagtgatggcagctgaaaac
attcctgaaaatccactgagatttctgtacccagatattcccaaagacaacgcctttggc
aaatactactccaggcctaaggaggccccagagcctatggatacagatactcccaaggga
aacggctacattaggactgaattaatctctgtatctgaagtccacccatccaggctccaa
tctccagaaaatctgctgcctatgtctcctgaagagtttgatgaggtatctcggatggtg
gatccagcagagattgacacagtaatgtgttcagcatacacggcgtaa

DBGET integrated database retrieval system