KEGG   Gallus gallus (chicken): 424063
Entry
424063            CDS       T01006                                 

Gene name
SATB2
Definition
(RefSeq) DNA-binding protein SATB2
  KO
K23226  DNA-binding protein SATB2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    424063 (SATB2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    424063 (SATB2)
SSDB
Motif
Pfam: CUTL CUT ULD Homeodomain
Other DBs
NCBI-GeneID: 424063
NCBI-ProteinID: NP_001186039
CGNC: 6166
Ensembl: ENSGALG00000008135
UniProt: E1BZL3 E1ANH5
Position
7
AA seq 731 aa
MERRSESPCLRDSPDRGSGSPDVKGPPPGKVARLEQNGSPMGTRGRPNGAVAKPVGGLMI
PVFCVVEQSDASLEYDNREEHAEFVLVRKDVLFSQLVETALLALGYSHSSAAQAQGIIKL
GRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQLQSCSKLEDLPAEQWNHATVRNALK
ELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERE
NLSDYCVLGQRPMHLPNINQLATLGKTNEQSPHGQIHHSTPIRNQVPTMQTMINPGLLSP
QLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFLNHPPIPRAVKPEPSNSSVEV
SPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSLLVNLRAMQN
FLNLPDSERDRIYQDERERSMNPNVSMVSSAASSPSSSRTPQAKTSTPTTDLPIKADGAN
VNITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCT
IRRFLNLPQHERDVIYEEESRHHHSERMQHVVQLTPEPVQVLHRQQSQPAKENSPPREEA
PPPPAEDSCAKKPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPKHTIIKF
FQNQRYHVKHHGKLKEHLGTVVDVAEYKDEELLTESEENDSEEGSEEMYKVEPEEENPEK
SKAAPADIDQR
NT seq 2196 nt   +upstreamnt  +downstreamnt
atggagcggaggagcgagagcccctgcctgcgggacagccccgacagaggcagcggcagc
cccgatgtcaaagggcccccccccgggaaggtggccaggctggagcagaacggcagcccc
atgggcacccgcgggaggcccaacggcgccgtcgccaaacccgtgggaggtttgatgatt
ccagtcttttgtgtggtggagcagtcggatgcctctcttgaatatgataatcgagaagag
catgctgagttcgttctggttcgcaaagatgtgctctttagccagctggtggagacagcg
ctcctggctctggggtattcccacagctctgcggctcaggcacaaggaataatcaagctt
gggaggtggaatcccctccctctcagttatgtgactgatgcaccagatgcaacagtagct
gacatgctacaagatgtctatcatgttgtgacattgaaaatccaattacaaagttgttcc
aagttggaagacttgccagcagagcagtggaaccatgccacagttcgcaatgccttaaag
gaactgctcaaagagatgaatcagagcacattagccaaagaatgccctctttcacagagt
atgatttcatccattgtaaatagcacatactatgccaatgtgtcagcaaccaagtgccag
gagtttgggagatggtacaaaaagtacaagaagattaaagtggaaagagtggaaagagaa
aacctttcagactattgtgttcttggtcaacgtcccatgcacttaccaaatatcaaccaa
ctggcaactttgggaaaaactaacgaacagtctcctcatggccaaattcaccacagtact
ccaattcgaaaccaagtgccaacgatgcagacaatgataaaccctgggctcctgtctcct
cagctcagtccacaactggtgaggcagcagatagcaatggcccatctgataaaccaacag
attgccgtcagccggctattggctcaccagcacccacaagctatcaaccagcagttcttg
aatcatccacccatccctagagctgtcaaaccagagccatcaaattcatcggtggaagtc
tctccagatatttaccagcaagtcagagatgagctgaagagagccagtgtatctcaagct
gtctttgcacgagtagcattcaaccgcacacagggcttgttgtctgagatcctgcgtaaa
gaagaagaccccaggacagcttcccagtccctcctggtaaacttaagggcaatgcagaat
ttcctcaacttgcctgactcggaacgggatcgaatctatcaggatgagagagagagaagc
atgaaccctaatgtgagcatggtgtcttcagcagccagcagcccaagctcctctagaact
ccccaggccaaaacctcgacaccaacaacagacctccccattaaggcggacggcgccaac
gtcaacatcacagctgccatttatgacgagatccaacaggagatgaaaagggccaaggta
tctcaagctctgtttgccaaagtggctgccaataaaagtcagggctggctgtgcgagcta
cttcgctggaaagaaaacccgagtccagaaaaccgcaccctctgggagaacctctgcacc
attcgccgcttcctgaaccttcctcagcacgagagggatgtgatctatgaggaggagtcc
agacatcaccacagtgagcgtatgcagcatgttgtccagctcactcctgagcctgtgcag
gtgctgcacagacagcagtcccagcctgcaaaggagaattccccaccgagagaagaggct
cctcctccacccgctgaggacagttgcgccaaaaagcccagatcccgcaccaagatatcc
ctggaagctctaggtatccttcaaagctttatccacgatgtaggtctctaccctgatcag
gaagccattcataccctctctgctcagctggatctccccaaacacaccatcatcaaattt
ttccagaaccaacgttaccatgtaaagcaccatgggaagctaaaagagcatttgggaaca
gtggttgatgtggcagagtacaaagatgaggagctgctgacagagtcggaggagaacgac
agcgaggagggctcggaggagatgtacaaagtggagcctgaggaggaaaaccccgagaaa
agcaaggcagctccagcagacatcgaccagagataa

DBGET integrated database retrieval system