KEGG   Gallus gallus (chicken): 424099
Entry
424099            CDS       T01006                                 

Gene name
ADAM23
Definition
(RefSeq) disintegrin and metalloproteinase domain-containing protein 23
  KO
K06837  disintegrin and metalloproteinase domain-containing protein 23 [EC:3.4.24.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    424099 (ADAM23)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     424099 (ADAM23)
Peptidases and inhibitors [BR:gga01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   424099 (ADAM23)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin Reprolysin_5 Reprolysin_3 EGF_2
Other DBs
NCBI-GeneID: 424099
NCBI-ProteinID: NP_001138702
CGNC: 6510
Ensembl: ENSGALG00000008582
UniProt: B8XA33
Position
7
AA seq 758 aa
MPQKDYKEADLHWNETAGRTEGVLADEENAFQLNRSSGGENNSHSSAIQKEITLPSGLIY
YINKDSETPYHVLDTRARHQQKHNKAVHLAQASFQIEAFGSKFILDLTLNNDLLSSNYVE
IHYEDGKQEFSKGGEHCYYHGNIRGIKDSKVALSTCNGLHGMFEDSAYVYLIEPMDLTHS
AESKSRPHIIQRTYGTRASMQLQDHETESSSEWPFISELLWLKRKRRRRAASRGVFEEMK
YLELMIVNDHKMFKKHRSSNAYTNNFAKSVVNLVDAVYKEQLNTRVVLVAVETWTDRDRI
NIHPDPLQMLHDFSKYRQHYIKQHADAVHLLSNVTFHYKRSSLSYFGGVCSVTRGVGVNE
YGLPLAMAQELAQSLAQNLGIQWEPAARKPKCDCTESWGGCIMEETGVYHSRKFSKCSIA
EYKEFLLRGGGACLFNRPTKLFETTECGNGYVEAGEECDCGFRMECYADCCKKCSLSNGA
HCSDGPCCNTSCLFFPRGYDCRYAVNECDIAEFCTGDSGQCPPNLHKQDGYACDSNQGRC
YNGECKTRDNQCKYIWGSKSSGSDKFCYEKLNTEGTKKGNCGKDGDRWIQCSKHDVFCGF
LLCTNLTKVPRVGQVQGEIIPNSFYHQGRIVDCSGAHVLLDDDTDLGYVEDGAPCGPQMM
CLDKKCLPIQSLNISSCPIGSNGKVCSGHGVCSNEATCICNFSWAGTDCSIDDPIRDTGN
KKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFK
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgccgcagaaagactacaaagaagcagacctgcactggaatgaaacggcaggcagaact
gaaggggtactggcagatgaagagaatgcatttcaactgaatagaagtagcggtggtgaa
aataacagccacagcagtgcaatccagaaagaaatcacactgccttcaggactcatttat
tacatcaacaaggactctgaaaccccttaccatgtcctggataccagggcaaggcaccag
cagaaacacaataaggctgtacatctggcccaggcaagtttccagattgaggcctttggt
tccaaattcatccttgacctcactttgaataatgatttgctatcttccaattatgtggag
attcactatgaagatggaaaacaggagttttctaagggtggggagcactgctactaccat
ggaaatatcagaggtatcaaggattccaaagttgctctttcaacttgtaatggacttcat
ggcatgtttgaagacagtgcttacgtgtacttgatagaaccaatggatttgactcacagt
gcagaaagtaaaagtaggccacacatcatccagagaacttatggaacacgagcctccatg
cagctgcaggaccatgagaccgaatctagttctgaatggccctttatctctgaactactg
tggctgaagagaaagagaagaaggagagcagcatctcgtggtgtctttgaagaaatgaaa
tatctggagctcatgattgtcaatgaccacaaaatgttcaaaaagcatcgttcttcaaat
gcatacacaaacaattttgcaaagtctgtggtgaaccttgtagatgctgtatacaaggaa
cagctgaacaccagggtggtccttgttgcggtggaaacttggacagacagagatcgcatt
aatattcaccctgacccactgcagatgcttcatgatttctccaagtatcggcagcactac
atcaaacagcacgctgatgctgtgcacctgctctcgaatgtgacatttcattacaaaagg
agcagcttaagttattttggaggggtttgctctgtgaccagaggagtaggagtgaatgag
tatggcctcccattagccatggcacaggaattagcacaaagccttgctcagaaccttgga
atacagtgggagccggctgccaggaaaccgaagtgtgactgcactgaatcctggggtggt
tgcatcatggaggaaacaggggtatatcattccagaaaattctccaagtgcagcatagca
gaatacaaagaatttttacttcgtgggggaggtgcctgtcttttcaacaggccaacaaag
ctctttgaaactactgagtgtggaaatggatatgtagaagcaggagaagaatgcgattgc
ggtttccgaatggaatgctacgcagactgttgtaagaagtgctctctttctaatggagct
cactgtagtgatgggccttgctgtaatacgtcgtgtcttttttttccacgaggctatgac
tgtagatatgcagtgaatgaatgtgatattgcagagttctgcactggagattctggccag
tgtccaccaaatcttcataaacaagatggatatgcttgtgattctaatcagggacgttgc
tataacggtgaatgcaagacaagagataatcagtgcaaatatatctggggatctaagtct
tccggatctgacaaattttgctatgagaagcttaatacagaaggcacaaaaaaaggaaac
tgtggaaaggatggagaccgatggattcagtgtagcaaacatgatgttttctgtggcttt
ttgctctgcactaatcttactaaagttccacgagttggtcaagttcaaggagaaattatc
ccaaattctttttatcatcaaggacgaatagtagactgcagtggtgctcatgttctctta
gatgatgatacagatttaggttatgtagaggatggagctccatgtggtcctcaaatgatg
tgtctggacaaaaagtgcctgccaattcaatccttgaacataagtagctgccccattggt
tcaaatggaaaagtctgttccggtcatggggtctgcagtaatgaagccacttgcatttgt
aatttctcctgggctgggacagactgcagtattgatgatcctatcagggatactggtaac
aagaaagatgaaggacccaagggtcctagtgccaccaatcttataataggctccatcgct
ggtgccatcctggtagcagctattgtccttggggggacaggatggggctttaagtaa

DBGET integrated database retrieval system