KEGG   Gallus gallus (chicken): 424142Help
Entry
424142            CDS       T01006                                 

Gene name
ATP5G3
Definition
(RefSeq) ATP synthase F(0) complex subunit C3, mitochondrial isoform 1
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
gga  Gallus gallus (chicken)
Pathway
gga00190  Oxidative phosphorylation
gga01100  Metabolic pathways
Module
gga_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    424142 (ATP5G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_C
Motif
Other DBs
NCBI-GeneID: 424142
NCBI-ProteinID: NP_001264784
CGNC: 52137
Ensembl: ENSGALG00000009286
UniProt: E1BV48
Position
7
AA seq 141 aa AA seqDB search
MFACAKLAASPALIRAGSRILYRPISASVFSRPEVRTGEGKSTLNGAQNAVSQLALREFQ
TSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcctgcgccaagctcgccgcttcgcccgccctgatccgcgctggatcgagaatc
ttgtacagaccaatttcagcatctgtgttttctaggccagaggtcaggactggagagggc
aaatccacacttaatggggcccaaaacgctgtctcccaactagcacttagagaattccag
actagtgctgtcagcagggacattgacactgctgccaaattcattggtgctggtgctgcc
acagtaggtgtggctggatctggtgctggtattggaacggtcttcggtagtctaatcatt
ggctatgccagaaatccttctctgaagcagcagctgttctcatatgctatcctgggattc
gccctgtctgaagctatgggtctcttctgtctgatggttgctttcttgatcctatttgcc
atgtga

DBGET integrated database retrieval system