KEGG   Gallus gallus (chicken): 424188
Entry
424188            CDS       T01006                                 

Gene name
SLC4A10
Definition
(RefSeq) sodium-driven chloride bicarbonate exchanger isoform X1
  KO
K13861  solute carrier family 4 (sodium bicarbonate transporter), member 10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    424188 (SLC4A10)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   424188 (SLC4A10)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto CPT
Other DBs
NCBI-GeneID: 424188
NCBI-ProteinID: XP_015145202
CGNC: 8443
Ensembl: ENSGALG00000030032
Position
7
AA seq 1119 aa
MQFLGVSGNRKVMQLGTGETLQSLSHQRNDEEAVVDRGGTRSILKTHFEKEDLEGHRTLF
IGVHVPLGGRKSHRRHRHRGHKHRKRDRERDSGLEDGRESPPFDTPSQRVQFILGTEDDD
EEHIPHDLFTELDEICWREGEDAEWRETARWLKFEEDVEDGGERWSKPYVATLSLHSLFE
LRSCILNGTVLLDMRANSIEEIADMILDQQVGSGQLSEDVRHRVHEALLKQHHHQNQKKL
SNRIPIVRSFADIGKKQSEPHSMDKNAGQIVSPQSAPACAENKNDVSRENSTVDFSKVDL
HFMKKIPPGAEASNILVGELEFLDRAVVAFVRLSPAVLLTGLAEVPIPTRFLFILLGPLG
KGQQYHEIGRSIATLMTDEVFHDVAYKAKDRNDLVSGIDEFLDQVTVLPPGEWDPTIRIE
PPKNVPSQEKRKIPGVPNGTAAHGEPEHPGGHSGPELQRTGKFFGGLILDIKRKAPFFWS
DFRDALSLQCLASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFG
GQPLTILGSTGPVLVFEKILFKFCKEYGLSYLSLRASIGLWTAILCIILVATDASSLVCY
ITRFTEEAFASLICIIFIYEALEKLFHLSETYPINMHNDLDLLTKYSCNCVEPEHPSNKT
LRYWQDYNISASDVPWGNLTVSECKKFHGEFVGRACGHHGPYVPDVLFWSVILFFSTVTL
SSTLKQFKTSRYFPTKVRSVVSDFAVFLTILSMVLIDYAIGIPSPKLQVPNAFKPTRDDR
GWFITPLGPNPWWTVIAAVIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMV
AVMLGVCSIMGLPWFVAATVLSISHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVL
MGSSVFLTSILKFIPMPVLYGVFLYMGASSLKGIQLFDRIKLFWMPAKHQPDFIYLRHVP
LRKVHLFTVIQLSCLVLLWIIKVSRAAIVFPMMVLALVFVRKLMDFFFTKRELSWLDDLM
PESKKKKLEDAEKEEEQSMLAMEEEGTVQLPLEGHYRDDPSVINISDEMAKTAVWKTLLI
SSENAKDKESSFPSKRQCKTGEREETDVGTFTAFKELFP
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgcaatttttgggggtctctggaaatagaaaggtcatgcagcttggaaccggtgagaca
ttacaatctttaagtcatcagagaaatgatgaggaagctgttgtggatagaggtggaact
cgctccattctcaaaactcattttgaaaaggaagatctagaaggtcatcgaacgttgttc
attggcgttcacgtgccactgggtggaagaaaaagtcacaggcgccataggcaccgtgga
cataaacacagaaaaagagacagggaacgagattcaggattagaagatgggagagagtct
cctccttttgatactccatcacaaagggtgcagtttattcttggaacagaagatgatgat
gaagaacacattcctcatgatctctttactgagcttgatgaaatttgttggcgtgaagga
gaggatgctgagtggagggagacagcaaggtggttgaagtttgaagaagatgtagaagat
ggtggggagaggtggagcaaaccatatgttgccacactgtcacttcatagcttgtttgag
ctgagaagctgtatcctgaatggcacagttttgttggacatgagagctaactccatagaa
gaaattgcagatatgattctggaccagcaggtgggctctgggcagctcagtgaggatgtt
cgtcatagagtacatgaggcattactgaaacagcatcaccatcagaaccagaagaaactg
agcaataggatcccgattgtgagatcctttgctgatattggaaagaagcaatctgagcca
cattccatggataaaaatgcaggtcagattgtttccccacaatctgctccagcctgtgct
gagaacaaaaatgatgtgagcagagaaaatagcacggttgactttagcaaggttgactta
cacttcatgaaaaagataccacctggagctgaagcatccaacatcttagttggtgagctg
gaattcctggaccgtgcagttgttgcttttgttaggttatcacctgcggtgctgcttaca
ggactagctgaagttccaattccaactagatttttgtttattcttcttgggccattgggt
aaaggacaacaatatcatgagattggaagatcaattgcaacgctgatgacagatgaggtg
ttccatgacgttgcttacaaagcaaaagaccgcaatgacttggtgtctggaattgatgag
tttcttgatcaggttacagttctccctcctggagaatgggacccaacaatccgaatagaa
ccacctaaaaacgttccctctcaggagaagcgtaagatcccaggagtaccaaatgggact
gcagctcatggggaaccagaacatcctggaggacactctggaccagaattgcaacgcact
ggaaaattttttggtggattgattttagatataaaaagaaaggctccattcttctggagt
gacttcagggatgctctcagtctacagtgtctggcatcatttttgtttctctactgtgct
tgcatgtctcctgtcatcacgtttggtggtctactgggagaagcaactgaaggtcgtata
agtgcaatagaatcgctgtttggagcatccatgactggaattgcctattccctctttggt
ggacagcctctcactatacttggcagcacaggaccagttctagtgtttgagaagatttta
tttaaattttgcaaagagtatggattatcatacctttccctgagagctagcattggactg
tggactgcaatcctgtgtatcatccttgttgcaactgatgcaagctccctagtctgttac
attacccggtttactgaagaagcttttgcttctcttatctgcataattttcatttatgag
gccttagagaagctatttcatctcagtgagacatatccaatcaacatgcataatgatttg
gacctgctgactaagtattcatgcaattgtgtggaaccagagcatcctagcaataaaacc
ttacgatactggcaggactacaatatatctgcatctgatgtgccatgggggaacctaact
gtgtcagaatgtaaaaagtttcatggagaatttgttggacgagcctgtggtcaccatggc
ccttatgttccagatgtccttttctggtctgtcatcttattcttttctacagtaactctg
tcatccacactgaagcagttcaaaaccagccgatacttcccaacaaaggtacgatctgtt
gtcagcgattttgctgtctttctcactattttgtccatggttttaattgactatgccatt
gggatcccatcaccaaaacttcaagttccaaacgcttttaagcccaccagagatgatcgt
ggatggtttattactcctttggggcctaatccttggtggacagtgatagctgctgtaatt
ccagccctgctttgtactatccttatttttatggaccagcagattacagctgtcattata
aacagaaaagagcataaactaaagaaagggtgtggataccatctcgacttactcatggtg
gcagtcatgcttggagtgtgttccattatgggattgccatggtttgttgcagccactgtc
ctctctatttctcatgtgaacagcttaaaactggaatcagagtgttctgctccaggggaa
cagccaaaatttcttggaatccgggagcagagagtcacagggctcatgatttttgtactt
atgggctcatctgtctttttgacaagtatcctgaagtttatccctatgccagtactttac
ggagtattcctttacatgggtgcttcatctctaaagggaattcagctttttgacaggata
aaattattctggatgcctgcaaagcatcagccagattttatttatctgaggcatgttcct
cttagaaaagtccatctcttcactgtaattcagctgagttgtcttgtactcctgtggatt
ataaaggtttcaagagctgccattgtctttcccatgatggtcttagctttggtatttgtc
agaaaactcatggatttctttttcactaaacgggagctcagttggttagatgatttgatg
cctgagagcaagaaaaagaaactagaagatgctgagaaagaggaagaacaaagtatgtta
gcaatggaggaggaagggactgttcagttgccgctagaaggacattacagagatgatcca
tctgtgataaacatttctgatgagatggcaaaaactgctgtgtggaagacgctgttgata
tcctcggagaatgcaaaagataaggagtcaagctttccttctaaaaggcagtgcaagact
ggagaaagagaagaaactgatgtgggtacattcactgcctttaaggaattattcccatga

DBGET integrated database retrieval system