KEGG   Gallus gallus (chicken): 424197Help
Entry
424197            CDS       T01006                                 

Gene name
INHA
Definition
(RefSeq) inhibin alpha chain precursor
  KO
K05500  inhibin, alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    424197 (INHA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    424197 (INHA)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   424197 (INHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 424197
NCBI-ProteinID: NP_001026428
CGNC: 8534
Ensembl: ENSGALG00000011234
UniProt: P43031
Position
7
AA seq 329 aa AA seqDB search
MLLLLHLLPAVLPASALGSCTGAGADRQLVLAKVRARVLEHLSPPAMQEPQKDVRRVHRR
DVLEEVEVPPEEQEDTSQVILFPSTDVPCEPTQPDKLLEEEGIFTYLFQPSAHALSRTLT
SAQLWFYSGPSAAPNHSAPAVLTLSPQGRVPVVATASRTPEHWTVFDFGPDALPQLAQPL
FVLLVRCPGCPCLADGDKMPFLVATTRAKAAGRARRSAVPWSPAALSLLQRPSEDVAAHT
NCRRASLNISFEELGWDNWIVHPSSFVFHYCHGNCAEGHGLSHRLGVQLCCAALPGTMRS
LRVRTTSDGGYSFKYETVPNILAQDCTCV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctcctgcacctgctgcctgccgtgctgcctgccagtgccctgggcagctgt
actggggccggcgccgaccgacagctcgtcctggccaaggtgcgggcacgggtgctggag
catttgagccccccggccatgcaggagccccaaaaggatgtgaggagggtgcaccgcaga
gatgtcctcgaagaggtggaggtgccacctgaggagcaggaggacacatcccaggtgatt
ctcttcccttccacagacgtgccgtgcgagcccacgcagccagacaagctgctggaggaa
gaaggcatcttcacttacctcttccagccctcggcgcacgccctgagccgcacgctgaca
tccgcccagctctggttctacagcggcccctcggctgctcccaaccactcggcccccgct
gtgctgaccctctcaccgcagggcagggtgccggtggtggccacagcgtcgcggacgccg
gagcactggaccgtgtttgacttcggccccgatgcgctgccccagctggcacagccgctc
ttcgtgctcctggtgcgctgccccggctgcccctgcctggccgatggggacaagatgccc
ttcctggtggccactacccgtgccaaggcagccgggagggctcgccgctccgccgtgccc
tggtcgccggctgcgctcagcctgctgcagcgcccatcggaggacgtggccgcccacacc
aactgccgccgggcgtccctcaacatctctttcgaggagctgggctgggacaattggatc
gtgcaccccagcagcttcgttttccactactgccacgggaactgtgccgaaggccacggg
ctgagccaccggctgggggtgcagctgtgctgcgccgcgctgcccggcaccatgcgctca
ctgcgtgtccgcaccacctctgatggtggctactccttcaagtacgagacggtgcccaac
atcctggcgcaggactgcacctgtgtctag

DBGET integrated database retrieval system