KEGG   Gallus gallus (chicken): 424222
Entry
424222            CDS       T01006                                 

Gene name
XRCC5
Definition
(RefSeq) X-ray repair cross-complementing protein 5 isoform X2
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    424222 (XRCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    424222 (XRCC5)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     424222 (XRCC5)
SSDB
Motif
Pfam: Ku Ku_N Ku_PK_bind Ku_C DUF6005
Other DBs
NCBI-GeneID: 424222
NCBI-ProteinID: XP_015145527
CGNC: 8733
Ensembl: ENSGALG00000011492
UniProt: A0A3Q2UA13
Position
7
AA seq 711 aa
MSSSAPGEESSLEQAKKVVTKFLQRQVFAESKDEVAVVLFGTDGTKNELASRDQYQNITV
HRSLMLPDFDLLEDIQNRIQLGSQQADFLDAIIVCMDLLQKETLGKKFEKRHIELFTDLS
SPVSEDQLEIIIANLKKTGISLQFFLPFPVDGADGHGDTSASIYSQLHRNSFPRKRLTAQ
QKEGVDVVKKLMHTLDEEGGLEEIYTFRESLERLAMFKKIERRPAAWSCQLTIGSNLSIR
IVAYKALTEEKVKKTWTVVDAKTLRKEDVQRETVYCLNDDDETEVQKDDTIQGFRYGSDI
VPFSKEDEEQMKYKTEAKCFSVLGFSRSSQIQRHCYMGNQVLKVFAAKDDENAAVAFSAL
VQALDELNVVAIVRYAYDRRCNPQIGVAFPCIKDTYECLFYVQLPYMEDVRQYMFSSLKN
NKKCTPTADQLSAIDSLIDSMNLVYEDHNGETFEDLFKPSKIPNPHFQRLYQCLQHKAFH
PNEPLPPIEQHLLEMLEVPCVVKERCKAPLEKVKALFPLKDAGKKKEEKTAQDIFKDDED
GPNAKRRKIEDEEDSFSIMKLAEGNVTSVGSVNPAEDFQILVRQKNADFKDVSQQLINRI
DQFLENRSSQYYMKGINCIRVFRGEAIKLSKVQCFNDFLQALKSKVEDKALADFWEIVVQ
DRISLITKDEAEGSSVTSEEAEKFLTPKEKKNENLPATDEGGDVDDLLDMM
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgagcagttctgctcctggggaggagtcctcactggaacaagccaagaaggttgtgacc
aagtttctgcagcgacaggtttttgctgagagtaaagatgaagttgctgtagttttgttt
ggcacagatggtactaagaatgaactcgccagtagggatcaataccaaaacattactgta
cataggtctctaatgctgccagattttgacttgttagaagacattcaaaataggattcag
ctaggctctcaacaagcagactttctggatgcaattattgtgtgtatggacttgcttcag
aaggaaacattaggaaagaaatttgagaagagacatattgaactgtttacagaccttagt
agtcctgtcagtgaggatcagttggaaattatcattgcaaacttgaagaaaacaggaatt
tcacttcaattttttttgccatttccagtggatggtgctgatggacatggagatacaagt
gccagcatatactcacagttgcaccgaaactcattcccaagaaagagattaactgcacag
caaaaggaaggcgttgatgtggtgaagaagttgatgcatactttggatgaagaaggaggg
ctggaagaaatatacactttcagagagagccttgaacgtcttgcaatgtttaagaaaata
gaaagaagacctgcagcttggtcatgccagttaactattggttccaatttgtctataagg
attgtggcctataaagcactcacagaagagaaggtgaaaaaaacttggacagttgtggat
gctaaaaccctcagaaaagaagatgtgcagagagaaaccgtttactgtttaaatgacgat
gatgagacagaggttcagaaagatgataccattcaagggtttcgctatgggagtgatata
gttcctttttccaaagaagatgaagagcaaatgaaatacaaaactgaagcaaaatgtttt
tctgttctgggattcagcagatcatctcagatccagaggcactgttacatgggcaaccag
gttctcaaggtctttgcagcgaaagatgatgagaatgcagcagttgctttttctgccctt
gttcaagcattggatgagttgaatgtcgtagctatagtgcgttatgcttatgatagaaga
tgtaacccacaaattggtgtagcttttccatgcataaaggatacatatgagtgtctcttc
tatgtgcaattaccatacatggaagatgtaagacagtacatgttttcatccttgaaaaac
aataagaaatgcactcctaccgcggatcagttatctgcgattgactccttgattgattct
atgaatttggtttatgaagatcacaatggagaaacgtttgaggacctgtttaagcccagt
aaaatcccaaaccctcattttcaaaggttataccagtgtttgcagcataaggcttttcac
cccaatgagccattgccaccaattgaacaacaccttttggaaatgctggaggtgccctgt
gtggtaaaagaaaggtgcaaggctccacttgaaaaagtaaaggcacttttccctctaaag
gatgctggcaagaaaaaagaagagaagactgctcaagatatctttaaagatgatgaagat
ggacccaatgctaagagaaggaaaattgaagatgaggaagatagctttagcatcatgaaa
cttgctgaaggcaatgtcacctctgttggcagtgttaacccagcagaagacttccaaatt
ctggtgaggcagaaaaatgctgacttcaaagatgtgagtcagcagctgataaaccgcatt
gatcagtttctggaaaacagaagttcacagtactacatgaaagggatcaattgtattcga
gttttcagaggggaggctataaagctatccaaggtgcagtgctttaatgattttctacag
gccttgaagtcaaaggtggaagataaagccttagctgatttctgggagattgtggtacaa
gacagaatttctttgatcacgaaagatgaagcagagggaagttcagtgactagtgaagaa
gctgaaaagttcttgactccaaaagaaaagaaaaatgaaaatctgcctgccacagatgaa
ggtggtgatgttgatgatttgctggacatgatgtga

DBGET integrated database retrieval system