KEGG   Gallus gallus (chicken): 424231
Entry
424231            CDS       T01006                                 

Gene name
CNTNAP5
Definition
(RefSeq) contactin-associated protein-like 5 precursor
  KO
K24338  contactin associated protein-like 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    424231 (CNTNAP5)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   424231 (CNTNAP5)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C Laminin_G_3 EGF PMP1_2 Protocadherin
Other DBs
NCBI-GeneID: 424231
NCBI-ProteinID: NP_001041544
CGNC: 8800
Ensembl: ENSGALG00000011577
UniProt: Q0V8S9
Position
7
AA seq 1305 aa
MDSPALGAVALLLAGFWHLGLTATNYNCDGALVSTLPSSAFTSSSEFFSTHSPSFAKLNR
RDGAGGWSPLDSNEQQWLQVDLGDRVEIVGVATQGRYGSSDWVTSYTLMFSDTGRNWKQY
RKDDTVWVFTGNSNADSVVHHKLLHSMKARFLRFVPLKWNVGGHIGLRVEVFGCSYKSDI
ADFDGRSSLLYRFNQKLMSTFKDVVSLKFKSMQEDGVLFHGEGQRGDYITLELQKGKLSL
HINLGDSNLHFTNSHTSVTLGSLLDDQHWHSVLIERFNKQVNFTVDKHTQHFRTKGDSDH
LDIDYELSFGGIPVPGKPGTFQRKNFHGCIENLYYNGVNIIDLAKRRKPQIYTGNVTFSC
SEPQIVPITFVSSSRSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTELSENSGSLLVYL
HGGRLTLLIQKVAEDPVEISEGTNLHDGLWHSLNINARRHRITLTLDNNAATASHATTVS
RIYSGNSYYFGGCPDNFTDSQCLNPITAFQGCMRLIFIDNQPKDLILVQQGSLGNFSDLH
IDLCDIKDRCLPNYCEHGGKCSQSWTTFYCDCNDTSYMGATCHNSIYEQSCEAYRHQGKT
SDFFYIDSDGSGPLGPLRVFCNITEDKIWTAVQHNNTGLTRVQGAGPEKPYTMSFNYNSS
AEQLEAVINSAEYCEQEAAYHCKKSRLLNTPNGIPFAWWVGRANEKHLYWGGSLPGIQQC
ACGLEESCLDMRYFCNCDADREEWTNDTGLLAFKDHLPVTQIVITDTNRSNSEAAWKIGP
LHCYGDRQFWNAASFNTEASYLHFPTFHAEVSADISFFFKTTSLSGVFLENLGMKDFIRV
EIRSPKEITFSIDVGNGPTEATVQSPTPLNDNQWHYVRAERNLKQTSLQVDNLPKKVLEA
PAEGHFRLQLNSQLFVGGTASRQKGFLGCIRSLHLNGQKLDLEERAKMTPGVKPGCPGHC
SSYGNLCHNGGKCVEKYNGYSCDCTSSAYEGPFCKEEVSALFEAGTSITYIFQEPYPVTK
NASTSSSAIYADAITSKENIAFSFLTAHAPSLLLYINTYFHEYLAVILSKNGSLQVRYKL
SKDGLLIFTIDSGNFANREMHHVKINREGRELIIQVDQVIKLKHNFSEIDFKAIKSLTLG
KVTDSLPLDPEVSKANAYGFTGCMSSVWYNHVAPLKAALRHPSIAPVTVKGSLTESSCSS
LMETDVNTATTIYSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFCIIAIMSRF
LYQHKQAHRSSQTKEKEYPENLESSFKADIDLQNTVSECKREYFI
NT seq 3918 nt   +upstreamnt  +downstreamnt
atggattccccagccctcggggctgtcgctctgctgcttgccggtttttggcacctggga
ttaaccgcgacgaactataattgtgatggtgcattggtatctaccttaccttcatcagcc
tttaccagttcttctgagttcttcagtactcacagtcccagctttgcaaagctcaacagg
cgagatggagctggaggctggtcccctctggactccaatgagcagcagtggctccaggtt
gatctcggagacagagtggagattgttggggtcgctacccagggcaggtatgggagctcc
gactgggtaaccagctacacgctgatgttcagcgacaccggccgcaactggaagcagtac
agaaaagacgacaccgtctgggttttcacagggaacagcaatgctgacagtgtggttcac
cacaaactcctgcactccatgaaagctcgcttcttgcgcttcgtccctctgaagtggaat
gtcggtggtcacatagggctgagagtggaggtcttcggctgctcctataagtcagatatt
gcagacttcgatggcagaagttccctcctctacaggttcaatcagaagcttatgagcaca
ttcaaagatgtggtttccttaaagttcaagagcatgcaggaggatggagtcttattccac
ggagaaggacaacgtggagactatattaccctggaattgcagaaagggaagctctccttg
cacatcaacctgggggactccaacctgcatttcactaacagccacacatccgtcacgctg
ggcagcctcctagatgaccaacactggcactcggttctcatagagcgcttcaacaagcag
gtgaacttcacagtggacaagcatactcagcattttcgaacgaagggggactcggatcat
ttagatatcgattacgagctcagctttggaggtattcctgtcccagggaaaccaggaacc
tttcagaggaaaaacttccatggctgcattgagaacctttattacaatggagtcaatata
attgacctggcaaaaaggcgcaaacctcagatctatactgggaatgtgaccttttcctgc
tcagaaccacaaattgttcccatcacgtttgtcagctccagtagaagctacttgttactg
cctggcactcctcaaattgatgggttgtcagtcagttttcagtttcgaacatggaataaa
gatggcttactcctgtccactgaattgtctgaaaattcaggatctcttttggtttacctc
cacggtgggagattgacacttcttattcagaaagtggcagaagacccagtggaaatcagt
gaaggcaccaatctccatgatgggctttggcattcacttaacatcaacgccagaagacat
cgcattaccctgacactggataacaatgctgccactgctagccatgcaaccactgtctca
agaatctactcagggaacagctactattttggagggtgccctgacaacttcactgattcc
caatgtttaaatcccattactgcttttcaaggctgtatgaggctcatctttattgataac
cagcccaaggacctcattttagttcagcaaggctccctggggaattttagtgatttacac
attgatctgtgtgacatcaaagacagatgtttgcctaactactgtgaacacggaggaaaa
tgctctcagtcctggaccacattttactgtgactgtaatgacacaagttacatgggggcg
acctgtcataactctatctatgagcagtcatgtgaggcttaccggcaccaagggaagaca
tcagatttcttctacattgattctgatggaagtggaccacttggaccgctccgggttttt
tgcaatataacagaagacaagatctggactgccgtgcagcacaacaacacagggctaacc
agagttcaaggagctggtccagagaagccctacaccatgtcctttaactacaacagcagc
gcagagcagcttgaagctgtgataaacagtgcagagtactgcgagcaggaggcagcctac
cactgcaaaaagtcacgtctcctcaacaccccgaatggaataccatttgcttggtgggtt
ggacgtgccaatgaaaagcatctttactggggaggatcacttccgggcattcagcagtgt
gcatgtggactggaagaaagttgtctggatatgagatatttttgcaactgtgacgcagat
agagaagaatggacaaatgataccggccttcttgctttcaaagaccatttgcctgtaact
cagatagtgatcactgacacaaacagatcaaattctgaggctgcttggaaaatcggtcct
ttgcattgctatggagacaggcagttctggaacgccgcttccttcaacacagaggcttcc
tacctgcacttccccaccttccacgctgaggtcagcgcagacatctccttcttcttcaaa
actacgtctctctctggagtgttcttggaaaaccttgggatgaaagacttcatacgagtt
gaaataagatcccccaaagagatcaccttctccatagatgttgggaacggccccacagaa
gcaactgtgcagtctcccacacccctgaatgacaatcagtggcactatgtccgagcagag
cggaacctcaagcaaaccagtctccaggtggacaacctccccaagaaggtcctggaggca
cctgcagaggggcactttcggttgcagctcaacagccaattatttgtaggaggaacagct
tccagacaaaagggctttttgggatgtattcgatctctgcacttaaacggacagaaactt
gaccttgaagaaagagctaaaatgactcctggtgttaaacccggatgtccagggcactgc
agtagttacggtaacctgtgccataatggaggaaaatgcgtggagaagtataatgggtat
tcttgtgattgcaccagctcagcctatgaagggcccttctgcaaggaagaggtttctgct
ttatttgaagctggcacttctattacctatattttccaagaaccttatcctgtcacgaaa
aatgcaagcacttcaagttctgccatttatgcggatgccatcacgtccaaggaaaatatt
gcatttagctttcttacggcacacgctccaagccttctgctgtacatcaacacctacttc
catgaatatttggctgtgattctctccaagaacggaagtttacaggttcgatacaagttg
agtaaggatggactgctcatcttcacaatcgactctggaaattttgctaacagagagatg
catcatgtgaagataaacagagaaggcagagagctcatcattcaggttgatcaagtcatc
aaactcaagcacaacttttctgagattgattttaaggccatcaaatcacttactttgggc
aaggtcacagatagtttaccactggaccctgaagtctcaaaggcaaacgcctatggtttc
actggctgcatgtcctctgtttggtataaccatgttgctcccctgaaagctgccttacgc
catcccagcattgctcccgtgactgtcaagggttccttgactgaatccagctgttcatcc
ctaatggaaactgatgtgaacacagcaaccacaatatattcctcttcagatccttttggg
aagacagatgaaagggagcctctcaccaatgcggtcagaagcgattctgctgtgattgga
ggtgtaatagcagttgtgatattcatcatcttttgcatcatcgccatcatgagcagattc
ctctatcagcacaaacaggcacatcgaagtagccaaacaaaggagaaggaatacccagaa
aatcttgagagctcttttaaagctgacattgacttgcagaacacagtgagcgagtgcaaa
cgagaatatttcatttga

DBGET integrated database retrieval system