KEGG   Gallus gallus (chicken): 424239
Entry
424239            CDS       T01006                                 

Gene name
NIFK
Definition
(RefSeq) MKI67 FHA domain-interacting nucleolar phosphoprotein
  KO
K14838  nucleolar protein 15
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gga03009]
    424239 (NIFK)
Ribosome biogenesis [BR:gga03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    424239 (NIFK)
SSDB
Motif
Pfam: hNIFK_binding RRM_1 RRM_7
Other DBs
NCBI-GeneID: 424239
NCBI-ProteinID: XP_422088
CGNC: 8852
Ensembl: ENSGALG00000011650
UniProt: F1NT45
Position
7
AA seq 277 aa
MAAAAAGAGAPASFLSLEPQLQSTVQKKVRRARKNRVAEEELTPGVVYVGHLPRGLCEPQ
LRQYFEQFGTVRRLRLSRSKKTGGSKGYAFIEFESDDVAKIVADTMNNYLFSERLLKCQF
MPPERVHANLFKNSERMFQKPSQPAVKRYNKVRSLVEKAKMAKRLLRKENCLRKRLAEKG
IKYSFPGFAAQGLPVKRKKVKRSKAKQNVSLTSQDPTPVCTPTVLERRKAQQADDDPDDN
EIIIKLPPPSVKKAVQRPKKQPRKKKQPEETKAGLKF
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcaggcgcaggggcgccagcgtcgtttttgtccctggagccgcag
ctgcagagcacggtccagaagaaggtgcggcgtgcccgtaagaaccgggtggccgaggag
gagctgacgccgggcgtggtgtacgtggggcacctcccgcgcgggctgtgcgagccgcag
ctccggcagtacttcgagcagttcggcaccgtccggaggctgcggctctccaggagcaaa
aagacaggagggagcaaaggctacgccttcatcgagttcgagtccgacgacgtggccaag
attgttgcagacacaatgaacaattacctcttttctgaaagactgctcaagtgtcagttc
atgcctcctgaaagggtccacgcaaacctcttcaaaaacagcgagcggatgtttcagaag
ccctctcagccagcagtgaagcggtacaataaggtccgttccctcgttgagaaggccaag
atggcgaagcggctgctgcggaaggagaactgtttgcggaagaggttggccgagaagggg
atcaagtacagcttccctggatttgctgcgcagggcctccctgtgaagaggaagaaagtt
aaaaggtccaaggccaagcagaatgtttctttgactagccaggatcctactccagtctgt
acgcctacagtgcttgagcgccggaaagctcagcaagcggatgatgacccagacgacaat
gaaataataatcaaactgccccctccaagtgttaagaaagctgtgcagagaccaaagaaa
cagccaaggaaaaaaaaacaacctgaagaaacaaaagcaggcttaaaattctga

DBGET integrated database retrieval system