KEGG   Gallus gallus (chicken): 424303Help
Entry
424303            CDS       T01006                                 

Gene name
ARHGAP15
Definition
(RefSeq) rho GTPase-activating protein 15
  KO
K20637  Rho GTPase-activating protein 15
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    424303 (ARHGAP15)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    424303 (ARHGAP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PH PH_9 RPEL DUF5617
Motif
Other DBs
NCBI-GeneID: 424303
NCBI-ProteinID: NP_001008476
CGNC: 9435
Ensembl: ENSGALG00000012421
UniProt: Q5ZMM3
Position
7
AA seq 475 aa AA seqDB search
MERSTTSDTASEKPNPSHSTGAVQMRIKNANSHHDRLSQSKSMILSDNVKVLEPINRHRR
NHSQHNLTLADIISTPDHTVVEKEGYLLKAKIADGGKKLRKNWSTSWIVLTSRKMEFYKE
SKQPALANLKPGYKPECVDLCGAHIEWTPEKSSRKNVFQITTVSGNEFLLQSDIDFLILD
WFHAIKNAIDRLPKERSCTSRNLEFKLRRSSSTELLNSLDTESKESKPEHRKSLIFRLNY
SASDSNDRSRVKSRLKKFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQ
CIKAVERRGLEVDGIYRVSGNLATIQKLRFVVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYCFFEQFVEAIKIQDNATRIKAVKTLVKKLPRPNYDTMKVLFEHLKKIAAKE
SVNLMSTQSLGIVFGPTLLRPEKETGNMAVHMLYQNQIVELMLSEYSKIFGSEED
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggtctacaacttctgacacggcctctgaaaagccaaatccttcccacagtaca
ggagctgttcaaatgaggatcaaaaacgccaacagtcaccatgacagactaagccaaagc
aaatctatgattctgtctgacaatgtgaaagtccttgagcctataaatcgtcacagaaga
aatcattcccaacataacttaacacttgcagacatcattagtacaccagaccacacggtg
gtggagaaagaaggatatcttctaaaagctaaaatagcagacggtggcaagaaattaagg
aaaaactggtccacgtcttggattgttcttacttctcggaaaatggaattctacaaagaa
tccaaacagccagcactggccaatctgaaaccgggatataaacctgagtgtgtggatttg
tgtggtgctcacattgagtggaccccagagaaatccagcagaaagaatgtctttcagatc
acgacagtgtcaggaaatgagttccttctccagtcggatatcgactttctcatattggat
tggttccatgctatcaaaaatgcaattgacagattgccaaaagaacggagttgtacatcg
agaaatttggagttcaaactcagaagatcctccagcaccgaattactgaatagcttagac
actgaatccaaagaatcaaagcctgaacacagaaaatctttaattttcagactgaactac
agtgcttctgactcaaatgacagaagccgagttaaaagcagattaaagaagtttatctcc
cgaagaccatccttgaaaacattgcaagaaaaaggactgattaaagatcaaatttttggc
tcccatttgcacttggtatgcgaacatgagaattctaccgtcccccagtttgtgagacag
tgtataaaagcagttgaaagaagaggtctagaagttgatggaatatacagagttagcggc
aatctggcaacaatacagaagttacgatttgttgtcaatcaggaagagaagctgaatttg
gacgacagccagtgggaggacatccacgttgtcaccggagcactcaagatgtttttcaga
gagctgcctgagccgctgttcccatactgcttctttgaacagtttgtggaggcgataaaa
attcaagacaatgccactcgcataaaagccgtgaagaccctggtaaaaaagctccctagg
ccaaactatgacacaatgaaagtcctctttgagcatctaaagaagatagcagccaaggaa
tccgtgaatcttatgtcaacacaaagcttaggaattgtgtttggaccaacactccttaga
cctgaaaaggagacagggaacatggcagtccacatgctgtaccaaaatcagatagttgaa
cttatgctgagtgagtacagcaagatcttcggctctgaggaagactga

DBGET integrated database retrieval system