KEGG   Gallus gallus (chicken): 424314
Entry
424314            CDS       T01006                                 

Gene name
NMI
Definition
(RefSeq) N-myc-interactor
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: NID IFP_35_N HAUS-augmin3 GAS DUF724 Csm1_N CHAD Alpha-2-MRAP_C Cnn_1N KfrA_N Tmemb_cc2 DUF1640
Other DBs
NCBI-GeneID: 424314
NCBI-ProteinID: XP_025008448
CGNC: 9480
Ensembl: ENSGALG00000012480
Position
7
AA seq 453 aa
MAAIPNMAGCPRDGRGAVTQRPAAAGEPLAPPPAGGKAKAEAGGRGREGGRERRPAGSSA
GPAAVPPLPQVPMDLSSSLYSLKDNGFLLTTPDPSDTSKDEMESLKQELEKWKERLEQAE
KTKADLQLSKAIADEEYMKILHELTELNDAQEELNKESAMSKAAYEEELCVLNQENAELK
REIEKLKEELAECCSALSQDGKIKKKVAEMKVVFTNMEDSEGDFPDMNTRCVFSVTTRIP
FKLNQNHALLTLEDEEVAQRLTKMGKHTVNLDGTTADVKVVPLTVGIGIKFELHITISGK
KISVSEIPELPIPDEWMRDKLELNFYKSEHGGGEVENIKYDKRSRTAVITFTRPGATASI
ARGTRYPFYVNGRCHRLSVSPSTDGHLEKLQLFSGISTKTILLKGIKETEDDEESVQDMI
EIHFQKPSNGGGETENIKYVSKGATWVCFEEDG
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcggctatccccaacatggcaggctgtccccgagatggaagaggagcggtgacacaa
cggcccgcagcagctggggaacctctggctcctcctccagcgggagggaaagcgaaagca
gaagccggcggccgcgggagggaagggggcagggagaggcgtcccgccgggagctccgca
gggcccgccgccgtcccgccgcttccgcaggttccaatggatttatcaagctcactgtat
tctttgaaagacaatggctttcttttgacaacccctgacccttctgacacgtccaaagat
gagatggaaagtcttaaacaagaactggagaaatggaaggaaagacttgaacaagctgag
aaaacaaaagctgaccttcaacttagcaaagcaattgctgacgaagaatatatgaaaata
ctgcatgagctgacagagctaaatgacgcccaagaggaacttaataaagaaagtgccatg
tctaaggctgcctatgaggaagaactttgtgtgctaaaccaagagaatgctgagctgaag
agagagattgagaagctcaaagaagagcttgcagaatgttgttcagcgctttcgcaggat
ggtaagattaaaaaaaaggtggcagaaatgaaagtggtgttcactaacatggaagactca
gagggtgactttccagatatgaatacccgctgcgttttttctgtaacaacaagaatccca
ttcaaactgaaccaaaaccacgcactgcttaccttggaagatgaagaagttgcccagaga
ctgacaaaaatgggtaagcatactgtgaacctggatggaactacagcagatgtgaaagtg
gtgcctttaacagttggaataggaatcaaatttgagctccacatcacaatttctggaaag
aagatcagtgtttcagaaatccctgagctaccaattcctgatgagtggatgagagacaaa
ttagagctgaatttctacaaatccgaacatggaggaggagaagtagaaaatataaaatat
gacaagaggtccagaacagctgttattacattcactagacctggagcaacggccagcatt
gcgagaggtaccagataccctttctatgtaaatggaaggtgccatagactttctgtgtcc
ccaagcactgatggacacttggaaaagcttcagctcttttctggtatttctacgaagacc
attctactgaaaggaattaaagagactgaagatgatgaggaaagcgtgcaggatatgatt
gaaattcatttccagaagcctagtaacggtggtggggaaacagagaatatcaaatatgta
tcaaaaggagctacgtgggtttgttttgaagaggacggttag

DBGET integrated database retrieval system