KEGG   Gallus gallus (chicken): 424353Help
Entry
424353            CDS       T01006                                 

Gene name
ZBTB41
Definition
(RefSeq) zinc finger and BTB domain-containing protein 41
  KO
K10513  zinc finger and BTB domain-containing protein 41
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    424353 (ZBTB41)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     424353 (ZBTB41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 BTB zf-met zf-C2H2_6 zf-C2H2_jaz Thioredoxin_2 zf-C2H2_2 zf-C2HC_2 zf-C2H2_3rep
Motif
Other DBs
NCBI-GeneID: 424353
NCBI-ProteinID: XP_004943180
CGNC: 1643
Ensembl: ENSGALG00000002305
UniProt: E1C1B5
Position
8
AA seq 905 aa AA seqDB search
MKKRRRLAANVNEKVHLGREKVASDQILVVDCAQEIVSKPAEIAPADQLESAPELSPSSE
QRKLLSSLQYNKNLLKYLNDDRQKRPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSK
NPSTDVVTLDHVTHSVFQHLLEFLYTSEFFVYKNEIPLVLEAAKFLDIIDAVKLLNNESV
SSIQSDVVTDTPTPVETLNELTGKLLNSHQCTFCGRSFCYKKSLENHLAKAHRSLSLERK
HGLKMVEKAGFSTRRSTRNRKCPVKFDDSDSESDDASDSNLEKVNSDKEPSDRSEFEDSG
SECNADEEGQEEEMSGEDSDTEEQSEKEHDTEEGSEVADSVGSIPEGLAPVIIQSSNKKL
LQCPKCDKKFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNLTVHRKKHSSDTDFHKK
EHKCPYCNKLHASKKTLAKHVKRFHPENVQEFLSIKKTKSEGWKCDICKKSFTRRPHLEE
HMILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKRHIECT
HGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDD
KRYECEECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVHYKSVHLGEKVW
QKYKATFHQCEVCKKVFKGKSSLEMHFRTHSGEKPYKCQICNQSFRIKKTLTKHMVIHSD
ARPFNCQHCNATFKRKDKLKYHIDHVHGTKAAEEALTSSSEEKLVSLPVPYTSDDKVYQT
EAKQYVEQPKTYQSEAKTLLQNVSTEVCVPVTLVPVQMPDPQADLVQHTTQSHGILPPQH
EQADYQRATDLSFLEKYTLTPQPANIVHPVRPEQMLDPRDQSYLGTLLGLDTAPTVQNIS
NNEHS
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaggagacggctcgctgcaaatgtaaacgaaaaggttcaccttggccgtgag
aaagttgcttcggatcagattcttgtagtagattgtgcccaggaaattgtctccaagcct
gcggaaatagctcctgcagatcagcttgaatctgccccagaactttcaccctcgtcggag
cagaggaagctcctaagctccttgcagtacaacaaaaacctgctcaagtacctaaatgac
gatagacagaagcgtccgtcgttttgtgatctactcataatcgtagaaggaaaagaattt
agtgctcacaaagttgtagtggctgttgggagtagttattttcacgcctgtttaagcaaa
aatccaagcactgatgtcgtcacgttagatcacgtaactcattctgtctttcagcatttg
ttggagtttctgtacacctctgagttctttgtatataaaaatgaaattcccctggtgctg
gaagcagcaaaatttttagatattatagatgcagtgaagttactgaataacgaaagtgtt
tctagcatccagtccgatgtggtaactgacacacctacaccagtagaaacgctaaacgag
ctgactggtaaactgctgaatagtcatcagtgcactttctgtggccgaagtttctgttac
aagaagtctttagaaaatcatttggctaaagcccacagatccctttcgctggagagaaaa
catgggctaaaaatggttgagaaagcaggcttttccactcgacggtccacgagaaaccgt
aagtgtccggttaaatttgatgatagcgatagcgaaagtgatgatgcatctgacagcaat
ttggaaaaagtcaattctgacaaggaaccatctgataggagtgagtttgaagacagtgga
agtgaatgtaatgctgatgaagaagggcaggaggaagaaatgtcaggtgaagattcagac
actgaagagcaaagcgaaaaagaacatgatactgaggagggttccgaggtagctgattct
gtgggaagcattcctgaaggcttagctccggtcatcattcaaagcagtaacaaaaaactg
ctgcagtgtcccaagtgtgacaaaaagtttgatcgaataggcaaatatgagagtcataca
cgtgtacacacaggtgagaagccttttgagtgtgatatatgtcatcagcgctattcaacg
aagtccaacctgacggtgcacagaaagaagcactcaagtgatacagactttcataaaaag
gaacataaatgtccctactgcaataagctgcatgcaagcaagaagacgttagcaaaacac
gtgaagaggtttcatccagagaatgtgcaagaatttctttctattaaaaagacaaagagt
gaaggttggaaatgcgatatttgtaagaagtccttcactcgcagacctcatttggaagag
catatgatccttcactctcaggataaaccatttaagtgtacctactgtgaagagcacttt
aaatcccgatttgcaagactgaaacatcaagaaaaattccatctcgggccttttccctgt
gacatttgtgggcgacagtttaatgatacaggaaatctgaaacgccacatagaatgtact
catggaggaaagagaaaatggacgtgcttcatctgtggcaaatctgttagggaacgaaca
actttgaaggagcatctgagaattcacagtggagagaagcctcatctttgcagtatttgt
gggcagagttttcgtcatggaagctcttacagacttcatctaagagtccaccatgatgac
aagagatatgaatgtgaagaatgtgggaaaacatttattcggcatgaccatctgaccaaa
cacaaaaaaatacattcaggagaaaaagcacatcagtgtgaagaatgtggaaaatgtttt
ggccgtagagatcacctcaccgttcattataaaagtgttcatctaggagaaaaggtttgg
cagaaatataaagcaacgtttcaccaatgtgaagtctgtaaaaaagtttttaaaggaaaa
tcaagtttggaaatgcattttaggacacattcaggtgagaaaccatacaaatgtcaaatc
tgtaatcagtcttttagaattaagaagacattaacaaagcacatggttattcattcagat
gctcgaccatttaattgccaacactgcaatgcaacatttaaacgaaaagacaaactgaaa
taccatatcgatcatgttcacggaacaaaggctgcagaggaggcactgacatcttcttcg
gaggaaaaactagtctccttaccagtaccatacacttccgatgacaaagtttatcagact
gaggctaaacagtatgtggagcagcccaaaacgtatcagtcggaagccaaaactttgtta
cagaatgtatctacagaagtttgtgtgcctgtgactctggttccagttcagatgcctgat
cctcaagctgatctagtacagcatactactcagtcacatggcattcttcctccacagcat
gagcaggcagattatcaacgcgcgacagatctatcgtttctagagaaatatactcttact
ccacagcctgcaaatattgttcatcctgtaagacctgagcaaatgttggatcctagagac
cagtcatatcttggaactttactgggcctggatacagctcctactgtacagaacatttca
aacaatgaacattcgtga

DBGET integrated database retrieval system