KEGG   Gallus gallus (chicken): 424365
Entry
424365            CDS       T01006                                 
Symbol
ATF6
Name
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 alpha isoform X2
  KO
K09054  cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    424365 (ATF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    424365 (ATF6)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    424365 (ATF6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 424365
NCBI-ProteinID: XP_015145885
CGNC: 1914
Ensembl: ENSGALG00000032278
Position
8:4100488..4171605
AA seq 670 aa
MAAAKAEWEPAGLLPAAGGGLDWETVLGEELGELLGAAESRRASRDEPDSFQENDLYNFH
FDLDLMSWDSDLWNITSHSYSDANVKTEPLSPAPSTCSVPSPSSVDSPVQNVPDDMDFSC
SSQMSPISLYCKSSRSPASPEGDAEKKPIVGVTSRSANNSVKTLKRCGQTASRPSIQPKP
LLPAVPEAQANIGIPAKTIIIQTLPTLVPLPKHQPVVNIQPAPPKGPSVVLPQPAVVQLQ
ASGVLPASQPVIAVTGGTTQLHNHTVGALPPTAGNGSANGKITVAKPLLQSTTPAVGLDL
NVLRRQQRMIKNRESAFQSRKKKKEYMLGLEARLEAALLENEKLKKENSTLKRQLDEVVL
ENQKLKVSSPKRRTLCVMVILAFIMLNYGPLSVFEKDPNGVDSTVSSNHRTRNLLEFSAS
KEPSPAQKIPIDIISEKINRYDNSVSDNKALMIVSEEPLLYISPPPPPCQPLINRTESQR
LNHELRGWVHRHEVERTRSRRKSNNQHQKARVMQSSVSQKVHSQLMTMPYTDTSLRNSGN
ELQVYYASPRSYQDFFEAIHRKEDTFYVVSFRRDHLLLPATTHNKTRRPKMSIVLPAVNI
NENVINGKDYEVMMQIDCEVMDTRILHIKSSSVPPYLREQRRNDTNTFYSSSSSVSETPH
ALRAIVKSLQ
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcggcggcgaaggccgagtgggagcccgcggggctgctgccggcggcggggggcggc
cttgactgggagacggtgctgggcgaggagctgggcgagctgctcggtgctgcggagtct
cggcgcgcctcgagggacgagcccgactcatttcaggaaaatgatctgtataactttcat
tttgacttggatttgatgtcctgggactcggacctttggaatatcacaagccactcttat
tcagatgcaaatgtgaagacggagcccttatcaccagcgccttcaacttgttcagtccct
tctccgtcctctgtggactctccagtgcagaatgtgcctgatgatatggacttcagctgc
agttcccagatgtctcctatctccctctactgcaagagctccagaagccccgcatcccct
gaaggagatgcagagaagaaaccgattgtgggcgtcacttctcggtctgcgaataattct
gtgaagactctgaagagatgtggtcagacagcatctaggccatcgatacaaccaaaacct
cttttgcctgctgtacctgaggctcaggctaacattggcatcccagctaaaaccatcatt
attcagacacttccaacacttgtgccactgccaaagcatcagccagttgttaacatccag
ccagcacctcctaaaggtccatcagtggtgctcccccagcctgcagtggtacagctgcag
gcttctggggtgcttcctgcctcccagccagtcattgctgtcacaggagggaccacgcag
cttcataatcacactgtgggtgcactgcccccgactgctggaaatggctcagcaaatggc
aaaatcacagtggctaaacccttgctccaaagcaccacaccggcagtggggctggacctc
aatgtgttgagaagacagcagcgcatgatcaaaaaccgggagtcagcctttcagtcacgg
aagaaaaagaaagaatacatgctaggactagaggccaggctggaggctgccttactggag
aatgaaaagctcaagaaagaaaacagcacgctgaagaggcagctggatgaagtggtgtta
gagaaccagaagctcaaagtatcatctcccaagagaagaaccctatgtgtgatggtgata
ctggcttttataatgttgaattacggtccgctcagtgtgtttgaaaaagatcccaatgga
gttgattccactgtgagttccaaccaccggaccagaaatctcctggagttctcagctagc
aaggagcccagcccagctcagaaaatacccatcgacataatttctgagaagattaataga
tatgataattctgtgtctgataacaaagcattgatgatagtatcagaagaaccactgttg
tatatttcacctccaccaccaccctgtcagcccctgatcaaccgaacagagtcacaaagg
ctgaatcatgaacttcgaggatgggttcatagacatgaagtggaaagaacaaggtctaga
aggaagtccaataaccagcatcagaaagcacgggttatgcagagctccgttagtcagaag
gtacattcccaactaatgaccatgccttacacagacacgagcctcaggaactcagggaat
gagctgcaagtgtattacgcctctccaaggagctatcaagacttctttgaagctattcac
aggaaggaagatacgttctacgtggtgtcatttcgcagagaccacctgttactgccagcc
accacacataacaagaccagaaggccaaagatgtctatagtgttgccagctgtaaacatc
aatgagaacgtgatcaatgggaaggactacgaggtgatgatgcaaatcgactgcgaagtg
atggacaccaggatcctccacatcaaaagttcatccgtccctccgtacctccgtgagcag
cgcaggaatgacaccaacaccttctacagctcgtcctcctctgtctcagagacaccccac
gccctgagggccattgtcaagtccctgcagtag

DBGET integrated database retrieval system