KEGG   Gallus gallus (chicken): 424366Help
Entry
424366            CDS       T01006                                 

Gene name
OLFML2B
Definition
(RefSeq) olfactomedin-like protein 2B
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF Noelin-1
Motif
Other DBs
NCBI-GeneID: 424366
NCBI-ProteinID: XP_422209
CGNC: 1922
Ensembl: ENSGALG00000002667
Position
8
AA seq 740 aa AA seqDB search
MARPLPLLLCLAALGAGCRAGPAPTGTAGPSAEPLQDEADNQENILSQLLGDYDKVKAVS
EGSDCRCKCLVRPLGRGACQRINQGSFRAEDFYTVETITSGPGCKCACVAPPSALNPCEG
DFRLQKLREADSGDLKLSSIVEMLESAFYGLDLLKLHSVTTKLVGRVERLEESMTRNATR
AGVNVEEPLSEPQRRGGENCSGLISNSLADIESSLQRDAEAAYVHPEGKYEERFLKDETI
SQQINSVESLAGLHLAPEEGKPEQLLQRKLSPRSRPPSKPTIVRGVTYYKAQSSESDNDI
EEQQDELFSGDNTVDLLIEDQLLRPSGRAGEAVRKPSPVGWPPTPSIEPSTAPTTLPLST
AASVGPTPEPTTASLPPPTMETATTASVLPEEETPQLPTASASVVALTATESPPVANSSV
PSPAVAATTTQTSWDVGMSPEPGTGSSPGPPEQASTPPPLSTTIPATPKQALEEEDIRNI
IGRCKDTLSTISGPTTQNTYGRNEGAWMKDPLAKEERIYVTNYYYGNTLVEFRNLDNFKQ
GRWSNSYKLPYSWIGTGHVVYNGSFYYNRAFTRNIIKYDLKQRYVAAWAMLHDVAYEEST
PWRWRGHSDVDFAVDENGLWVIYPAISYEGFNQEVIVLSKLNAADLSTQKETTWRTGLRK
NFYGNCFVICGVLYAVDSYNKRNANISYAFDTHTNTQIIPRLLFENEYAYTTQIDYNPKD
RLLYAWDNGHQVTYHVIFAY
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggctcggccgctgccgctgctgctctgcctggccgcgctgggcgccggctgccgggca
gggccggcccccaccggcaccgccgggccctccgccgagccgctgcaggacgaggcggac
aaccaggagaacatcctctcgcagctgctaggcgactacgacaaggtgaaggcggtgtcc
gagggctccgactgccgctgcaagtgcctggtgagacccctgggacgcggcgcctgccag
cgcatcaaccagggctccttccgtgccgaggacttctacaccgtggagaccatcacctcg
gggcccggctgcaagtgcgcctgcgtggcccccccctcggcgctcaacccctgcgagggg
gacttcaggctgcagaagctgcgggaggcggacagcggagacctgaagctgtcctccatt
gttgagatgctagaaagtgccttctatggcctggacctgctgaagctgcattcggtcaca
acgaagctggtgggccgggtggagaggctggaggagagcatgaccaggaatgccacgcgg
gcgggagtgaacgtggaggagcccctatcagagccccagcgccgtggcggggagaactgc
tccggcctcatctccaacagcctggccgacatcgagagctcgctgcagcgggacgcggag
gctgcctatgtgcaccccgagggcaagtacgaagaaaggttcctgaaggatgaaaccatc
tcgcagcagatcaattctgttgagtccctcgcagggctgcacctcgctcccgaggagggg
aagcccgagcagctcctgcagaggaagctgagcccgcggagccgccctccctccaagccc
accattgtgcggggggtcacctactacaaggctcagtcctccgagtccgacaatgacatc
gaggagcaacaggacgagctgttcagtggggacaacaccgtggatctgctgatcgaggac
cagctgctgcggcccagtgggcgggcgggtgaggctgtgaggaaaccatccccagtgggg
tggccgcccacccccagcatcgagcccagcacggcgccaaccaccctgcccctgtccact
gccgcctccgtggggccgacaccggagcccaccactgccagcctgccaccccctaccatg
gagactgcaaccacggcctcggtgctgcccgaggaggagaccccgcagctgccgacagcg
tcagccagcgtggtggcactcacggccaccgagagcccgcccgtggccaacagctccgtc
cccagccccgccgtggccgccaccaccacccagacctcatgggatgtggggatgagccct
gagcctggcacggggagcagcccgggacccccagagcaggccagcacccccccgccgctc
agcaccaccatccccgccaccccgaagcaggccctggaggaggaggacatcaggaacatc
attggacgctgcaaggacacgctgtccaccatctcggggcccaccactcagaacacctac
gggcgcaacgagggggcctggatgaaggaccccctggccaaggaggagcggatctatgtc
accaactactactacggaaacacgctggtggagttcaggaacctggacaacttcaagcaa
gggcgctggagcaactcctacaagctcccctacagctggatcgggacggggcacgtcgtc
tacaacgggtccttctactacaaccgggccttcacccgcaacatcatcaaatacgacctg
aagcagcggtacgtggccgcctgggccatgctgcacgacgtggcctacgaggagtccacc
ccgtggcgatggcgcggccattccgatgtggacttcgccgtggacgagaacggcctgtgg
gtcatttacccggccatcagctacgagggcttcaaccaggaggtgatcgtgctgagcaag
ctgaacgcagccgacctcagcacccagaaagagacgacgtggaggacgggcctgcggaag
aacttctatgggaactgcttcgtcatctgcggggtcctgtacgcggtcgacagctacaac
aagaggaacgccaacatctcctacgcctttgacacgcacaccaacactcagatcatcccc
cggctgctctttgagaatgagtacgcctacaccacgcagatagactataaccccaaggac
cgcctgctctacgcttgggacaatggccaccaggtcacctaccacgtcatctttgcctac
tga

DBGET integrated database retrieval system