KEGG   Gallus gallus (chicken): 424377Help
Entry
424377            CDS       T01006                                 

Gene name
SEC22B
Definition
(RefSeq) vesicle-trafficking protein SEC22b precursor
  KO
K08517  vesicle transport protein SEC22
Organism
gga  Gallus gallus (chicken)
Pathway
gga04130  SNARE interactions in vesicular transport
gga04145  Phagosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    424377 (SEC22B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    424377 (SEC22B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    424377 (SEC22B)
Membrane trafficking [BR:gga04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    424377 (SEC22B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Longin Synaptobrevin IMD Sec20
Motif
Other DBs
NCBI-GeneID: 424377
NCBI-ProteinID: NP_001026437
CGNC: 52179
Ensembl: ENSGALG00000039704
UniProt: Q5ZJW4
Position
8
AA seq 215 aa AA seqDB search
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMA
FHYIIEKGVCYLVLCEAAFPKKLAFAYLEDLQSEFDEQHGKKVPTVSRPYSFIEFDTYIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcttaccatgatcgcccgcgtggcggacggactgccgctcgctgcctccatg
caggaggatgagcagtccggccgcgacctgcagcagtaccagagccaggcgaagcagctg
ttccgcaagctgaacgagcagtcccctacgaggtgcactctggaggcaggagccatggct
ttccactacatcattgagaaaggggtgtgttacctggtcctgtgcgaagctgcgttcccg
aagaaactggcctttgcatatctggaagacttgcaatcagaatttgatgagcagcatggc
aagaaggtgccgacggtttccaggccctattccttcattgaattcgacacctacatccag
aaaaccaagaagctctacatcgacagccgggcgaggaggaacctgggttccatcaacaca
gagctgcaggatgtgcagaggattatggtggccaacattgaggaagtcttacagcgagga
gaggcactttcagctctggattccaaggccaacaacttgtccagtttgtccaagaagtac
cgtcaggatgcaaagtacctgaacatgcgttccacttacgccaaactcgcggctgtagct
gtgttttttatcatgttgatcgtctatgtgagattctggtggctgtga

DBGET integrated database retrieval system