KEGG   Gallus gallus (chicken): 424405
Entry
424405            CDS       T01006                                 

Symbol
ALDH9A1
Name
(RefSeq) 4-trimethylaminobutyraldehyde dehydrogenase
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00053  Ascorbate and aldarate metabolism
gga00071  Fatty acid degradation
gga00280  Valine, leucine and isoleucine degradation
gga00310  Lysine degradation
gga00330  Arginine and proline metabolism
gga00340  Histidine metabolism
gga00380  Tryptophan metabolism
gga00410  beta-Alanine metabolism
gga00561  Glycerolipid metabolism
gga00620  Pyruvate metabolism
gga01100  Metabolic pathways
Module
gga_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    424405 (ALDH9A1)
   00053 Ascorbate and aldarate metabolism
    424405 (ALDH9A1)
   00620 Pyruvate metabolism
    424405 (ALDH9A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    424405 (ALDH9A1)
   00561 Glycerolipid metabolism
    424405 (ALDH9A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    424405 (ALDH9A1)
   00310 Lysine degradation
    424405 (ALDH9A1)
   00330 Arginine and proline metabolism
    424405 (ALDH9A1)
   00340 Histidine metabolism
    424405 (ALDH9A1)
   00380 Tryptophan metabolism
    424405 (ALDH9A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    424405 (ALDH9A1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     424405 (ALDH9A1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     424405 (ALDH9A1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 424405
NCBI-ProteinID: XP_422248
CGNC: 2550
Ensembl: ENSGALG00000003495
Position
8
AA seq 579 aa
MRKPTTFQPSRSKPCAAGQPEPRRYRWAVRSPPSREGALERRRRRERGSVRRRGAEPRGG
ARCRPMVLAFLLPRLRRLQPGLAMSTATGTFSLQQPLNYRAGGRVQPVDGGQTEDVYEPA
TGRVITKLLCSGEKEVDLAVQSAKAAFQTWSRTSGMERCRVLLEAARLIRERRDEIATLE
TINNGKSIFEARVDIDISWQCLEYYAGLAGSLAGEHIQLPGGSFGYTRREPLGVCVGIGA
WNYPFQIACWKSAPALACGNAMVFKPSPFTPISVLKLAEIFTEAGVPKGLFNVVQGGAAT
GQFLCHHPDVAKISFTGSVPTGVKIMEMAAKGIKPVTLELGGKSPLIIFSDCSLENAVNG
ALMANFLTQGEVCCNGTRVFVERKILDTFTKEVVKRTQKIKIGDPLQEDTRMGALINRPH
LERVQRFIKQAKEQGAQVLCGGDLYVPEDPKLKNGFYMQPCVLGNCRDDMTCVQEEIFGP
VMSILPFDTEEEVVERANNTKFGLAGGVFTRDIQKAHRVVAALKAGMCFINNYNVSPVEL
PFGGYKSSGFGRENGRAAIEYYSQLKTVCVEMGDVESVF
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgagaaagccaaccaccttccaaccttccaggagcaaaccctgcgcggcggggcagccg
gagccgcgccgctaccgctgggcggtgcgctctcctccgagccgcgagggggcgctcgag
cgccggaggcgtcgcgagaggggctcagtgcgcaggcgcggcgcggagccccgtggcggt
gcgcggtgccgtcccatggtgctggcgttcctcttaccccggctccgccgcctgcagccc
ggcctcgccatgagcaccgccaccggcaccttctccctgcagcagcccctcaactaccgg
gcgggcggccgcgtgcaacccgttgacggcgggcagaccgaggacgtgtacgaaccggcc
acgggccgagtgataaccaagctgctgtgctccggggagaaggaggtggacctggccgtg
cagagcgccaaggctgccttccagacatggagccgcacgtcgggcatggagcgctgccgt
gtgctgctggaggctgccaggctcatccgggaacggagagatgaaattgccaccttggaa
accatcaacaatgggaaatccatctttgaagccagggtggatattgacatatcctggcag
tgcctggagtattacgcaggactggcgggatctctggctggtgaacacatccagcttccc
gggggatcctttgggtacactcgcagagagcccctgggtgtgtgtgttgggattggagcc
tggaattaccctttccagattgcttgttggaagtctgccccagccctggcatgcggcaac
gctatggtcttcaagccctctcctttcacccccatttctgtgctgaagttggcagagatc
ttcacagaggccggtgtgcccaaggggctcttcaacgtggtgcagggtggagcggccaca
ggacagttcctctgccaccacccagatgtggccaaaatctctttcactggcagtgtgccc
actggcgtaaagatcatggagatggcagctaaagggatcaaaccagtgaccttggagctg
gggggcaaatccccccttatcatcttttcggactgctccctggagaatgccgtgaatgga
gccctcatggccaacttcctcacacagggagaggtgtgctgcaatggcacacgggtgttt
gtggagaggaagatactggacaccttcacaaaggaggtggtgaaacgcacccagaaaatc
aaaattggagacccacttcaggaagacacacggatgggagccctcatcaaccgaccccac
ctggaacgtgtccagcgctttatcaagcaggcaaaggagcagggtgctcaggtgttgtgc
gggggagacctgtatgtaccagaagacccgaagctgaagaatggcttctacatgcaaccg
tgcgtgttagggaactgcagagacgacatgacatgtgtgcaggaagagatctttgggcct
gtcatgtccattctgccatttgacacagaggaggaggtcgtggagagagccaacaacacc
aaatttggcctggcaggtggtgtcttcaccagggatatccagaaggctcacagggtagta
gctgctctcaaggctgggatgtgcttcattaacaactacaatgtcagccccgtggagctg
cctttcgggggatacaagtcatcaggatttggcagagagaacgggcgggcagccatcgag
tactactcgcagctgaagactgtctgcgtggagatgggtgatgtggaatctgtgttttag

DBGET integrated database retrieval system