KEGG   Gallus gallus (chicken): 424485Help
Entry
424485            CDS       T01006                                 

Gene name
CNN3
Definition
(RefSeq) calponin-3
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Calponin CH CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 424485
NCBI-ProteinID: NP_001341600
CGNC: 4166
Position
8
AA seq 331 aa AA seqDB search
MTHFNKGPSYGLSAEVKNKIALKYDPQIEEDLRNWIEEVTGLSIGANFQLGLKDGIILCE
LINKLQPGSVKKINQSKLNWHQLENIGNFIKAIQVYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQARSFDAGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKHILQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDDYHGEYQDDYQRDYHGQYSDQGIDY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacccacttcaacaaggggccctcttacgggctctccgccgaggtcaagaacaagatt
gccctgaagtatgatccccagatagaagaagaccttcgtaactggatagaagaggttaca
ggcttgagcattggtgcaaactttcagctggggctaaaagatggcatcatcttatgcgag
cttataaataagctgcagccaggatcagtgaagaaaattaatcaatcaaaactaaattgg
caccagctggagaacattgggaattttatcaaagcgatccaagtctatggcatgaagcca
cacgatatttttgaagccaatgatctttttgaaaatggaaatatgactcaagtacagact
actctcgtggcactagcaggtctggcaaaaaccaaaggttttcatactacaattgatatt
ggtgtcaaatatgctgagaaacaagcacgaagttttgatgcaggaaaactaaaagctggt
caaagtgtaattggcctacagatgggcaccaataagtgtgccagtcaggcgggcatgact
gcttatggaactagaagacacctctacgatccaaaaatgcaaactgataagccatttgac
cagacaacaatcagcctacagatgggcactaacaaaggagccagtcaggctggtatgctg
gcaccaggtaccagaagagacatctatgatcagaagcacatattgcaacctgtggataac
tcgactatttcattacaaatgggcaccaacaaagtagcttcacagaagggaatgagtgtg
tatgggcttggacggcaagtgtatgaccccaagtactgtgctgcaccaacagaacccgtc
attcataatggcagccaaggaacaggaactaatgggtcagaaatcagcgatagcgattat
caggcagaatacccagatgactatcacggagagtaccaagatgactatcaaagagattac
catggtcagtacagtgaccaaggcattgattactag

DBGET integrated database retrieval system