KEGG   Gallus gallus (chicken): 424512
Entry
424512            CDS       T01006                                 

Gene name
ZNF326
Definition
(RefSeq) DBIRD complex subunit ZNF326
  KO
K13204  zinc finger protein 326
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    424512 (ZNF326)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    424512 (ZNF326)
SSDB
Motif
Pfam: AKAP95 zf-C2H2_2 zf-Di19
Other DBs
NCBI-GeneID: 424512
NCBI-ProteinID: NP_001006533
CGNC: 4587
Ensembl: ENSGALG00000006113
UniProt: Q5ZJ02
Position
8
AA seq 566 aa
MDYGEAEDRDWRFPDTPMHCGVNMPSGSVSDMDRDYGHGGYGGPRSMDSYLNQSYGMESH
GGGGGGGGGGGNRFGPYESYDSGSSLGGRDLYRSGYGYNEPEQSRFGGSYGGRFDNSYRN
SLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRESYSSYSSFSSPHMKPAPVGSRGRGT
PAYPESGFGSRNYDAFGGPSTGRGRGRGHMGDFGGMHRPGIVVDYHNKPSPAAVAARGIK
RKMMPQPYNKPGGTFIKKPKMTKPILKLTQKKSSNMKSSFQDSTIEEIEVDTSGAVVIYE
DFTRDAYDVGYQTFGDSKGEGKSEEEEKRRIEARREKQRRRREKNSEKYGDGYRMAFTCS
FCKFRTFEEKEIESHLESAAHQETLDHIQKQTKFDKVVMEFLHECMVNKFKKTAMRKQQT
SNQTENAQAVEKDIMEGVTADDHMMKVETVHCSACSVYVPALHSSVQQHLKSPDHTKGKQ
AYREQIKRESVLTATSILNNPIVKARYELYVKGENPFEINDQAQEQQTEEEDKAEEPAEG
EEEEEEEEEEETEEQTDFTLDHTEDN
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggactacggggaagctgaagacagagattggagattcccagatacccccatgcattgt
ggtgtgaacatgcccagtgggtcagtctcagacatggaccgtgattatgggcatggaggc
tatggtggcccacgatccatggactcttaccttaaccagtcctatgggatggagagtcat
ggaggtggaggcggaggaggtggtggtggtggtaacaggtttggaccttatgagtcttac
gactccgggtcttctctgggtgggcgagatctgtacagatctggctatggttataatgaa
cccgaacaaagccgcttcggaggtagttatggtggtcgatttgacaactcctaccggaat
agccttgactctttcggaggtagaaaccagggcgggtctagctgggaagcaccttactcc
cgttcaaaattgaggcctgggtttatggaggacagaggaagagagagttactcttcctac
agcagtttttcttcaccccatatgaagcctgcacctgtaggctctcgggggagaggaacg
cctgcttatcctgaaagtggatttggaagcagaaactatgatgcttttggaggaccatca
acaggcagaggccgaggccgaggacatatgggtgactttggaggaatgcacagacctgga
attgttgttgactatcataacaaacccagccctgcagcagttgctgcaagaggaataaaa
aggaaaatgatgccacagccatacaacaaacctggtgggacatttatcaagaaacccaaa
atgacaaaacctattttgaagttgacacagaaaaaatcatctaatatgaagtcatctttc
caggactctactatagaggaaattgaagtggacacaagtggtgcagttgttatatatgaa
gactttacaagagatgcgtatgatgttgggtatcagacttttggagattccaaaggagaa
ggtaaaagtgaagaggaggaaaagcggcgaattgaggccagaagagagaagcaaaggcgt
agaagggaaaaaaacagtgagaaatatggtgatggatacagaatggcatttacttgctca
ttttgcaaatttcgaacatttgaagaaaaggaaattgaatcccatctggagagcgcagct
caccaggaaacactggatcatattcagaagcaaaccaaatttgacaaagtagtgatggag
tttcttcatgagtgtatggtgaataaattcaagaagacagctatgcgtaaacaacagact
agtaaccaaacagaaaatgctcaagctgttgaaaaagatatcatggaaggggttactgct
gatgaccatatgatgaaagttgagactgttcactgcagtgcttgcagtgtatatgttcct
gcactgcacagttctgttcagcagcacttaaagtctcctgatcacacaaaaggaaaacaa
gcctacagagaacaaataaaaagggagagtgttcttactgctaccagtatcttgaataat
ccaatagtcaaggcacggtatgagctgtatgtgaagggtgaaaatccttttgaaatcaac
gatcaggctcaggagcagcagacagaagaggaagacaaggctgaagagccagctgagggc
gaggaagaagaggaagaagaagaggaggaagaaactgaagagcaaactgattttacttta
gaccacactgaagataattaa

DBGET integrated database retrieval system