KEGG   Gallus gallus (chicken): 424523
Entry
424523            CDS       T01006                                 

Gene name
CLCA1
Definition
(RefSeq) calcium-activated chloride channel regulator 1-like
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    424523 (CLCA1)
Ion channels [BR:gga04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   424523 (CLCA1)
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_CoxE VWA_3
Other DBs
NCBI-GeneID: 424523
NCBI-ProteinID: XP_422360
CGNC: 52209
Ensembl: ENSGALG00000006322
UniProt: F1P490
Position
8
AA seq 935 aa
MWGQGQIMGVFRSLIFLLSFQLLHVAKGSMVKLNESGYEDLVVAINPSVTEDANIILNTK
AMIKDASNYLFEATKHRFFFKSVKIILPKTWKKNSTYSRLKTESYNKADVIIADPYLKYG
DDPYTLQYGGCAMKGRYIHFTPNFLLDSSMIKVYGERGRVFVHEWAHLRWGVFDEYNNDA
PFYVSENARVEPTRCSAGVTGKPVFRNCNGNQCTTRECQYDGQLYEAGCVFVPDLNQNSK
NSIMYMQSLPSVVEFCDKNTHNSEAPNMQNKMCNYKSTWEIIMESDDFRNSSVVNSLVPP
FETTFELLQTQDRAVSLVLDVSGSMNTNNRITNLRTAAEVFLIQIIEIGSRVGIVTFESS
AYEKSPLLQITSVATRQRLVQNLPTTAGGGTKICAGIEKGLEIITNAIGTTYGSEIVLLT
DGEDSTMSLCREKVKESGAIIHTIALGPSAAKELEEFSNITGGLQLYAVDVDVPSKLVEA
FSEITTGSGDISEQSIQLESKDQEVVSSGWINSTVTIDKTVGNDTFFVFSWSKKQPLFFV
RDPKGKEYGSSDFTIDSSNLKTARLSINGTAEVGDWHYYIQNVATVQNISVTVTSRAASS
DVSPVILQAYMERANIAPNPVVVYAEVSQNFLPVLGATVIATIEKDGATAVSLPLFDNGA
GADMTKNDGIYSRYFTSLSGDGRYSLKVSAQGRDQTIRLGRRQNRALYVPGYIENGEIQM
NAPRPELADEEIQANLGSFSRTSTSSFKLDNSGISPTSSPQGFPPCKITDLNAYIENETV
VLTWTAPGGDFDSGKADHYIIKSSANLWNLRDGFENATSVNSSHLAPQEAGSTETLTFKP
EHLTIENGTVIYIAIRAVDDTNLTSDTSNIAKATWFVPPKASVPSDDEGNTSDGVNIAVI
VAVVAGCVVLVCIIVSSTVCILQNKKKRKDRAIRM
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgtggggacagggacaaataatgggtgtgtttaggagtttgatatttttgctgtctttt
cagctcctgcatgtggcaaaaggctccatggtgaagctaaatgagagcggctatgaggat
ttggttgttgcaattaatcccagcgtgacagaagatgccaacatcatcctgaacacaaag
gcaatgatcaaagatgcttctaattatttgtttgaagctacaaaacatcgatttttcttc
aagtctgtaaaaattatactccctaaaacatggaagaaaaacagcacctattcaagatta
aaaacagaatcatataacaaggcagatgtcatcatagcagacccttatttgaaatacgga
gatgacccctataccttacagtatggaggatgtgcaatgaaaggacgatacatccatttc
acacccaacttcttgttagatagcagcatgattaaagtttatggagaaagaggtagagtt
tttgtccatgagtgggctcaccttcggtggggtgtgtttgacgaatataataacgacgca
cctttttatgtttctgaaaatgcacgtgttgaaccaacaaggtgttcagctggtgtcact
ggtaaacctgtattccgaaactgcaatggaaaccagtgtacgacaagagaatgccaatat
gatggtcagctatatgaagctggatgtgtatttgtaccggatctcaatcaaaacagcaaa
aattctattatgtatatgcagtccttaccttctgtggttgaattctgtgataaaaatact
cataattctgaggctccaaatatgcagaataagatgtgcaactacaaaagcacatgggaa
ataatcatggaatctgatgactttcgcaactcatctgttgttaatagccttgtacccccc
ttcgagactaccttcgagctactgcagactcaagacagagcagtctcattagtattggat
gtttctgggagcatgaacacgaataaccgcatcacaaatctccgtactgctgcagaagtg
tttctaatccaaattattgaaatcggctccagggttggaattgtcacatttgaatcttct
gcatatgaaaaaagtcctttgttacaaataaccagtgttgcaacacgtcaaagacttgtt
cagaatttgcctacaactgctggtggaggaaccaaaatctgtgcaggcattgagaaagga
ctggagataattaccaatgcaattggtacaacatacggttcagaaattgtgttactgaca
gatggagaggattcaactatgtcactttgccgtgaaaaagtgaaagaaagcggggcaata
attcataccattgcactgggtccatcagcagcaaaagaactagaagaattttcaaatatc
acagggggtttacaactttatgctgtagatgtagatgtccccagtaaactagtggaagca
ttcagtgaaattactacaggaagtggcgatatttctgaacaatctattcagctcgaaagc
aaagaccaagaagttgtttcttcaggatggataaatagtactgtgaccattgacaaaact
gtgggaaatgacactttctttgtcttttcatggagcaaaaaacaaccacttttctttgtg
agggaccccaaaggaaaagaatatggaagctcagacttcacaattgacagctcaaattta
aaaacagctagactcagtataaacggcactgcagaggtgggagattggcattattacatt
caaaatgttgctacagtacaaaatatatcagtaacagttacctctcgagcagcctcttct
gatgtttctcctgtgatcttgcaagcctacatggagagggcaaatatagcacctaatcca
gttgttgtttatgcagaggttagccaaaacttcttgcctgttcttggtgcaacagtgata
gccaccatagagaaggatggtgctactgcagtaagccttcctctttttgataatggcgca
ggtgctgatatgaccaagaatgatggaatctactcaaggtactttacttctttaagtggt
gatggaagatacagtctaaaagtgagtgcccaagggagagatcaaaccatcagacttggc
cgtaggcaaaatagagccttgtatgtaccaggctacatagaaaatggtgaaattcagatg
aatgcaccgagacctgaattggctgatgaagagatccaagctaatctgggaagtttcagc
agaacttcaacaagttcttttaaactggacaactctggaatttcaccaacaagttctcca
caaggttttccaccctgtaaaattacagacctcaatgcttatatagaaaatgaaacagta
gtgttgacttggacggctccaggaggtgactttgacagtggaaaagctgatcactacata
ataaaaagtagtgcaaatctttggaatctaagagatggatttgaaaatgctacttctgtg
aattcctctcatctcgcacctcaggaggctggtagcacagaaacattgacatttaaacca
gaacatttgacaatagaaaatggtaccgtaatctacattgccatacgtgctgttgatgat
acaaacttgacttcagatacgtctaatatagcaaaggccacatggttcgttcctccgaaa
gcatctgtgccttcagatgatgaaggcaacaccagtgacggtgttaacattgcagtaata
gtggcagttgtagctggatgtgtagtacttgtctgtattattgtaagttcaactgtgtgt
attttacaaaacaaaaagaaaagaaaggatcgtgcaatcagaatgtaa

DBGET integrated database retrieval system