KEGG   Gallus gallus (chicken): 424533
Entry
424533            CDS       T01006                                 

Gene name
VTG2
Definition
(RefSeq) vitellogenin-2 precursor
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Vitellogenin_N DUF1943 DUF1944 VWD
Other DBs
NCBI-GeneID: 424533
NCBI-ProteinID: NP_001026447
CGNC: 52212
Ensembl: ENSGALG00000001863
UniProt: P02845
Position
8
AA seq 1850 aa
MRGIILALVLTLVGSQKFDIDPGFNSRRSYLYNYEGSMLNGLQDRSLGKAGVRLSSKLEI
SGLPENAYLLKVRSPQVEEYNGVWPRDPFTRSSKITQVISSCFTRLFKFEYSSGRIGNIY
APEDCPDLCVNIVRGILNMFQMTIKKSQNVYELQEAGIGGICHARYVIQEDRKNSRIYVT
RTVDLNNCQEKVQKSIGMAYIYPCPVDVMKERLTKGTTAFSYKLKQSDSGTLITDVSSRQ
VYQISPFNEPTGVAVMEARQQLTLVEVRSERGSAPDVPMQNYGSLRYRFPAVLPQMPLQL
IKTKNPEQRIVETLQHIVLNNQQDFHDDVSYRFLEVVQLCRIANADNLESIWRQVSDKPR
YRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLLTVSLTLHLLQADEHTLPIAADLM
TSSRIQKNPVLQQVACLGYSSVVNRYCSQTSACPKEALQPIHDLADEAISRGREDKMKLA
LKCIGNMGEPASLKRILKFLPISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQI
LADQSLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRLP
FMYNISSACNIALKLLSPKLDSMSYRYSKVIRADTYFDNYRVGATGEIFVVNSPRTMFPS
AIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYKQIKELGKALQGWKEL
PTETPLVSAYLKILGQEVAFININKELLQQVMKTVVEPADRNAAIKRIANQIRNSIAGQW
TQPVWMGELRYVVPSCLGLPLEYGSYTTALARAAVSVEGKMTPPLTGDFRLSQLLESTMQ
IRSDLKPSLYVHTVATMGVNTEYFQHAVEIQGEVQTRMPMKFDAKIDVKLKNLKIETNPC
REETEIVVGRHKAFAVSRNIGELGVEKRTSILPEDAPLDVTEEPFQTSERASREHFAMQG
PDSMPRKQSHSSREDLRRSTGKRAHKRDICLKMHHIGCQLCFSRRSRDASFIQNTYLHKL
IGEHEAKIVLMPVHTDADIDKIQLEIQAGSRAAARIITEVNPESEEEDESSPYEDIQAKL
KRILGIDSMFKVANKTRHPKNRPSKKGNTVLAEFGTEPDAKTSSSSSSASSTATSSSSSS
ASSPNRKKPMDEEENDQVKQARNKDASSSSRSSKSSNSSKRSSSKSSNSSKRSSSSSSSS
SSSSRSSSSSSSSSSNSKSSSSSSKSSSSSSRSRSSSKSSSSSSSSSSSSSSKSSSSRSS
SSSSKSSSHHSHSHHSGHLNGSSSSSSSSRSVSHHSHEHHSGHLEDDSSSSSSSSVLSKI
WGRHEIYQYRFRSAHRQEFPKRKLPGDRATSRYSSTRSSHDTSRAASWPKFLGDIKTPVL
AAFLHGISNNKKTGGLQLVVYADTDSVRPRVQVFVTNLTDSSKWKLCADASVRNAHKAVA
YVKWGWDCRDYKVSTELVTGRFAGHPAAQVKLEWPKVPSNVRSVVEWFYEFVPGAAFMLG
FSERMDKNPSRQARMVVALTSPRTCDVVVKLPDIILYQKAVRLPLSLPVGPRIPASELQP
PIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSELKFLV
MMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASLWIHNE
NQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNGYLAKN
AVSFGHSWILEEAPCRGACKLHRSFVKLEKTVQLAGVDSKCYSTEPVLRCAKGCSATKTT
PVTVGFHCLPADSANSLTDKQMKYDQKSEDMQDTVDAHTTCSCENEECST
NT seq 5553 nt   +upstreamnt  +downstreamnt
atgagggggatcatactggcattagtgctcacccttgtaggcagccagaagtttgacatt
gacccaggattcaatagcagaaggagttacctgtacaactatgaaggttctatgttgaat
gggcttcaagacagaagtttgggcaaagctggtgtgcgcttgagcagcaagctagagatc
agtgggctaccagagaatgcttacctcctcaaggtccgctctccacaagtggaggagtac
aatggggtctggcccagggatcccttcactcgatcttccaaaatcacccaagtgatctca
tcgtgtttcacccggctcttcaaatttgaatacagcagtggacggatcggaaacatttat
gccccagaagactgcccagatctgtgtgttaacatagtgagaggaatattgaacatgttc
cagatgaccattaaaaaatcacagaacgtctacgaattacaagaggctggaattggaggt
atttgtcatgcaaggtatgtcattcaggaagacaggaagaatagccgaatctatgttacc
agaactgtggacttgaataattgccaggaaaaggtgcaaaaaagcattggaatggcttac
atctatccctgccctgtggacgtgatgaaagaaaggctcaccaaagggaccaccgctttc
tcctacaagctgaagcagtcagacagcggcacgctgatcacagatgtctcgtcgcggcag
gtgtatcagatctccccattcaatgagcccactggggtggctgtcatggaagcaagacag
cagctcactttggtcgaggtgagaagtgagcggggcagtgccccagatgtccccatgcag
aactatggcagccttcgctaccgcttcccagccgtactgccacagatgccacttcagctg
atcaagacaaaaaaccctgagcaacggatagtagaaacgctgcagcacatagtcctgaat
aaccaacaagatttccatgacgatgtttcatacagattcttagaggtggtccagctttgc
cggatagcaaatgctgacaatcttgagtctatctggagacaagtttcagataaacctcgt
tacaggcgatggctcctgagcgcagtttctgcgagtggcaccacagaaacactaaaattc
cttaagaacagaattcgcaatgatgacctcaactacattcagacccttctaactgtttct
ttgactcttcatttattgcaagctgatgaacacacacttccaatagcagcagatttaatg
accagctctcgaattcagaaaaatcctgtgcttcagcaagtggcctgcttgggatatagc
tctgtagtcaacagatactgctctcagacctcagcatgtcctaaggaagctcttcagccc
atccatgacctggcagatgaagcaatcagcaggggccgtgaagacaaaatgaaattagct
ctaaagtgcattggtaacatgggagaaccagccagcttaaagcgcatcctgaagttcctt
ccaatatcttcatccagtgctgctgatatcccagtccacattcagatagatgccataacg
gccttgaaaaagatagcttggaaggaccccaaaacagtgcagggctatctcatccagatc
cttgcagaccaatcacttccccctgaggtgcgaatgatggcttgtgctgttatctttgag
acaaggcctgcccttgctttgataacgactatagctaacgtggcaatgaaggagagcaat
atgcaagtggccagttttgtatattcccacatgaagtctttgtcaaagagcagattgcca
tttatgtacaacatatcttccgcttgtaacattgcccttaagctcctgtcccccaaactg
gacagtatgagctatcggtacagcaaggtcattcgagcagacacttactttgataactat
agagttggtgctactggagaaatctttgttgtgaacagcccaagaactatgttcccatca
gcaataatttccaaattgatggcaaattctgcaggttcagtggctgatctggtagaggtt
ggcatccgagtggaaggcctcgcagatgtcataatgaaaagaaacatcccatttgctgaa
tatcccacatacaagcagataaaggagcttggaaaagctctgcagggatggaaagagctg
ccgacagaaacccctttggtatcagcctacttgaaaatacttggccaagaagtggccttc
atcaacatcaacaaggaactcctgcaacaggtcatgaagactgtagtggaacctgctgat
cgaaacgcagcaataaagagaatcgccaaccagatccgcaacagcattgcagggcagtgg
acgcagccggtgtggatgggagagctgcgatacgtggttcccagctgtctcggcctgccg
ctggagtacgggtcctacaccaccgccctggcacgagctgcagtcagcgttgagggaaag
atgacgccgcctttaaccggagatttcagactttctcagttgcttgaatccaccatgcag
attcggtctgacttaaagcccagtttatatgtgcatacagttgcaacgatgggtgtcaac
acagaatactttcaacatgctgttgaaattcaaggcgaggtccagacaagaatgccaatg
aagtttgatgccaagatagatgtgaaattgaaaaaccttaagattgaaacgaacccatgc
cgtgaggaaactgagatagtggttggaagacataaggcttttgctgtatcaaggaacata
ggagaactaggtgttgaaaagaggacctcaattctgccggaagatgctccattagatgtt
acagaagaacctttccaaacatcagagagagcttccagggaacacttcgcaatgcaaggg
cctgacagcatgccaaggaaacagtcccatagttctcgagaagatcttcgccgtagcaca
ggaaaaagagcacataaacgagacatttgcctcaaaatgcatcatattggttgccagctt
tgcttttccagaaggtcaagagatgccagtttcatacagaatacgtatttgcacaaatta
attggagaacatgaagctaaaatagttttgatgccagttcatacagatgctgatattgac
aaaattcagctggagattcaggcaggatctagagcagctgccagaataattactgaggta
aacccagagtctgaggaagaggatgaatcatctccatatgaggacattcaagctaaactg
aagaggattctaggcattgacagtatgttcaaggttgcaaacaaaacacggcacccgaaa
aatcgaccatctaagaaaggaaacactgtgctagcagagtttgggacagagcctgatgca
aaaacttcctccagctcatcttctgcctcctcaactgccacctcttcttcctcatcatct
gcctcctctcctaatcgtaaaaagcctatggatgaagaggagaatgatcaagtaaagcaa
gcaagaaacaaagatgcaagcagcagcagcaggagcagcaagagcagtaacagcagcaag
agaagcagcagcaagagcagtaacagcagcaagagaagcagcagcagcagtagcagtagc
agtagcagcagcaggagcagcagcagtagcagcagtagtagcagtaacagcaagagcagc
agtagcagcagcaagagcagcagtagcagcagcaggagcagaagcagcagcaagagcagc
agtagcagcagcagcagtagcagcagcagcagcagcaaaagtagcagtagtaggagcagt
agcagcagcagcaagtcaagcagtcaccatagccatagccatcattcagggcatctaaat
ggcagcagcagcagcagcagcagcagcaggtcagtgagtcaccacagccatgagcatcac
tcaggacatctggaagatgacagcagtagcagcagcagcagcagcgtgctttccaaaata
tgggggcgtcatgagatttatcagtatcgctttagatcagcacacagacaagagttcccc
aaaagaaaactcccaggtgaccgcgctaccagcagatactcctctaccagatccagccat
gacacatcccgagctgcttcctggcctaagtttctgggtgacatcaaaaccccagtgtta
gctgcttttctccatggcattagtaacaataagaagacaggaggcctccagcttgtggta
tatgctgataccgactcggtcaggccgcgggtgcaggtatttgtgacaaacctcacagat
tcgagcaagtggaagctctgcgcagatgcttcggtccgcaatgctcacaaggcagtggcc
tacgtgaaatggggctgggactgccgggactacaaggtttctactgagctggtaactggg
cggtttgctgggcaccctgctgcacaagtgaagctggagtggcccaaggttccttcgaat
gtcagatcagtggttgaatggttttacgagtttgtccctggggctgcatttatgctgggt
ttctctgagagaatggacaagaatccttctcgacaagccaggatggttgtggctctaact
tctccgaggacatgtgatgttgttgtcaagctgcctgatataatcctctatcaaaaagcc
gtgaggcttcctctatcactccctgtgggtccaaggatcccagcttcagagctgcagcct
ccaatctggaacgtctttgctgaagccccctctgccgtgctcgagaatttgaaagctcgc
tgctcagtttcgtacaacaagatcaaaacctttaatgaagtcaagttcaactactcgatg
cccgcaaactgctatcacatcttggttcaggattgcagctctgaacttaagttcctggtg
atgatgaaaagtgctggagaagctacaaaccttaaagccatcaacatcaagattggcagt
catgaaattgatatgcatcctgtgaatggacaggtgaaactgctggtagatggggctgag
agccccacagccaacatttccctcatatctgctggtgcttctctgtggattcacaatgaa
aaccaagggtttgcacttgctgccccaggccatggtatcgataaattgtacttcgatgga
aaaacaatcacgattcaagttcctttatggatggcagggaaaacatgtggaatctgtgga
aaatatgatgcagaatgcgaacaggagtatcggatgcccaatggatatctagctaaaaat
gccgtgagctttggtcattcttggatcttggaagaagcgccctgtagaggagcttgtaaa
ctgcatcgttcattcgtgaagcttgagaagacggttcagctggcgggtgttgattccaag
tgctactctacagagcctgtgctgcgctgtgcaaagggatgctctgctaccaagacaact
ccagtaactgttggcttccactgcctcccagctgattcagctaacagcctaactgacaaa
cagatgaagtacgaccagaagtcagaagacatgcaggatactgttgatgcacacacaacg
tgttcatgtgagaatgaggaatgcagtacatga

DBGET integrated database retrieval system