KEGG   Gallus gallus (chicken): 424590
Entry
424590            CDS       T01006                                 

Symbol
UROD
Name
(RefSeq) uroporphyrinogen decarboxylase isoform X3
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00860  Porphyrin and chlorophyll metabolism
gga01100  Metabolic pathways
gga01240  Biosynthesis of cofactors
Module
gga_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    424590 (UROD)
Enzymes [BR:gga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     424590 (UROD)
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-GeneID: 424590
NCBI-ProteinID: XP_004936798
CGNC: 7774
Ensembl: ENSGALG00000010219
Position
8
AA seq 326 aa
MTRSCVRHAARRRSTPRCGVCGRQDATCLPLRRFPLDAAIIFSDILVVPQALGMEVVMVP
GKGPTFPEPLKEVEDLLKLRQKVDVTAELGYVFQAITLTRHSLEGKVPLIGFSGAPWTLM
SYMVEGGGSTTMAKAKSWLYRHPEASHRLLRLLTDVVTDYLVGQVAAGAQALQLFESHAG
HLGPEQFQEFALPYIRDIARDVKSKLKAEALSLVPMIVFAKDAHYALRDLAQAGYEVVGL
DWTIQPQEARAQVGKGVTLQGNLDPCALYAPKEKIGELVKKMLENFGTQRYIANLGHGLY
PDMNPEHVGAFVEAVHAHSRHINKHG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgacacgttcctgcgtgcggcacgcggcgaggagacggagcacaccccggtgtggtgta
tgcggcaggcaggacgctacctgcctgccactcagacgattccccctggatgctgctatc
attttctctgacatcttggtggtgccccaggcactgggcatggaggttgtcatggtccct
ggcaaaggacccacatttccagagcccctgaaggaggtggaggatctgctgaaactacgg
cagaaggtggacgtgactgcagaactgggttacgtcttccaggccatcacactgacgcgg
cacagcctggagggcaaggtgcccctcattggcttctccggggcaccttggacgcttatg
tcctacatggttgaagggggtggttccactacaatggcaaaggccaagagctggctgtac
cgtcaccctgaagcaagccaccgactgctgcggctgctgactgatgttgtcactgactac
ctggtggggcaggtggctgctggagcgcaggcgctccaactgtttgagtcccatgcaggg
catttaggtccagaacaatttcaggagttcgccctgccatacatccgagacattgcccgg
gatgttaagagcaagctgaaagcagaggcactgtcactggtgcccatgattgtctttgcg
aaggacgcacactacgcactgcgtgatttggcacaagctgggtacgaggttgttggtctt
gactggaccatccagccccaggaagctcgtgcacaggtcgggaaaggtgtcaccttgcaa
ggaaacctagatccctgcgctctctatgcacccaaggagaagattggggaactggtgaag
aaaatgctggagaactttgggacccaacgctacatcgccaacctgggccatggcctctac
ccagatatgaaccccgagcacgtgggtgcctttgtggaggctgtgcatgctcattcccgc
cacatcaataaacatggctga

DBGET integrated database retrieval system